Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183636

Zinc Finger Protein 36, C3H Type, Homolog (Mouse) (ZFP36) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms G0S24, GOS24, NUP475, RNF162A, TIS11, TTP, zfp-36, c3h-1, g0s24, gos24, nup475, rnf162a, tis11, ttp, Gos24, Nup475, TIS11D, TISII, Tis11, Ttp, Zfp-36, ZFP36, C3H-1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183636
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZFP36 antibody: synthetic peptide directed towards the N terminal of human ZFP36
Sequence MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSL SPSDSSPSGV
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against ZFP36. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZFP36
Background ZFP36 is a probable regulatory protein with a novel zinc finger structure involved in regulating the response to growth factors. Knockdown of ZFP36 increased both cognate macrophage gene mRNAs and inflammatory tumor necrosis factor protein release. Overexpression of ZFP36 resulted in decreased levels of the same genes supporting its role in regulating macrophage gene expression. Multiple phosphorylation sites in ZFP36 in mammalian cells were reported. ZFP36 can be phosphorylated by JNK as well as by the other members of the greater MAP kinase family. Gene expression profiling predicts clinical outcome of prostate cancer. Inappropriate ZFP36 production may be one factor that contributes to higher rheumatoid arthritis disease activity.
Molecular Weight 34kDa
Gene ID 7538
NCBI Accession NP_003398, NM_003407
UniProt P26651
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZFP36 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cao, Deterding, Venable et al.: "Identification of the anti-inflammatory protein tristetraprolin as a hyperphosphorylated protein by mass spectrometry and site-directed mutagenesis." in: The Biochemical journal, Vol. 394, Issue Pt 1, pp. 285-97, 2006 (PubMed).

Alternatives for antigen "Zinc Finger Protein 36, C3H Type, Homolog (Mouse) (ZFP36)", type "Antibodies"
Hosts (19), (19)
Reactivities (38), (7), (5), (4), (3), (3), (2), (2), (2), (1)
Applications (35), (19), (10), (10), (7), (3), (1), (1)
Epitopes (5), (2), (2), (2), (2), (1), (1)
Beacon