Did you know that you can buy products from over 140 different suppliers from us?

Transcriptional Adaptor 3 (TADA3) (N-Term) antibody

Details for Product No. ABIN183709
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ada3, ada3-B, ngg1, tada3l, tada3l-B, TADA3L, ADA3, NGG1, STAF54, hADA3, 1110004B19Rik, AI987856, Tada3l, fa03f04, tada3, wu:fa03f04, zgc:63596
Epitope
N-Term
(11), (8), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human, Zebrafish (Danio rerio), Chicken
(37), (6), (5), (3), (3), (3), (3), (3), (1)
Host
Rabbit
(30), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (1), (1), (1)
Application
Western Blotting (WB)
(36), (21), (11), (3), (3), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183709
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TADA3L
Sequence MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGI EELDTLQLEL
Predicted Reactivity Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against TADA3L. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TADA3L
Background Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually
Molecular Weight 49 kDa
Gene ID 10474
NCBI Accession NM_006354, NP_006345
UniProt O75528
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 432 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Validation Images
back to top