Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183709

Transcriptional Adaptor 3 (TADA3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ADA3, NGG1, STAF54, TADA3L, hADA3, Tada3l, 1110004B19Rik, AI987856, fa03f04, tada3, wu:fa03f04, zgc:63596
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human, Zebrafish (Danio rerio), Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183709
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TADA3L antibody: synthetic peptide directed towards the N terminal of human TADA3L
Sequence MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGI EELDTLQLEL
Predicted Reactivity Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against TADA3L. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TADA3L
Background Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually
Molecular Weight 49kDa
Gene ID 10474
NCBI Accession NP_006345, NM_006354
UniProt O75528
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TADA3L antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "Transcriptional Adaptor 3 (TADA3)", type "Antibodies"
Hosts (19), (7)
Reactivities (26), (6), (6), (3), (3), (3), (3), (3)
Applications (25), (13), (6), (3), (3), (3)
Conjugates (1), (1), (1)
Epitopes (6), (2), (2), (2), (2), (2), (1), (1)
Beacon