Did you know that you can buy products from over 140 different suppliers from us?

ERGIC and Golgi 2 (ERGIC2) (N-Term) antibody

Details for Product No. ABIN183775
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Erv41, PTX1, cd002, Ptx1, AA408438, 1200009B18Rik, 4930572C01Rik, RGD1310606, zgc:64005, ptx1, MGC75899
Epitope
N-Term
(8), (7), (3), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Dog (Canine), Human, Chicken
(16), (6), (4), (2), (2), (1), (1)
Host
Rabbit
(17)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (9), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183775
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ERGIC2
Sequence MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIA FTTMALLTIM
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Human : 100 %, African clawed frog : 90 %, Dog : 90 %, Mouse : 90 %, Pig : 90 %, Rat : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against ERGIon Channel2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ERGIC2
Background ERGIon Channel2 possibly play role in transport between endoplasmic reticulum and Golgi. ERGIon Channel2 is downregulated in prostate cancer. ERGIon Channel2 may play an important role in the growth and tumorigenicity of PC-3 prostate tumor cells. Ectopic expression of a partial sequence of ERGIon Channel2 as a VP22-fusion protein in prostate cancer cell line, PC-3, induced cellular senescence. Interferon-beta (IFN-beta) and a number of IFN-inducible genes were upregulated by the ERGIon Channel2-VP22 fusion protein.
Molecular Weight 43 kDa
Gene ID 51290
NCBI Accession NM_016570, NP_057654
UniProt Q96RQ1
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 377 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ERGIC and Golgi 2 (ERGIC2) (N-Term) antibody WB Suggested Anti-ERGIC2 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Breuza, Halbeisen, Jenö et al.: "Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46." in: The Journal of biological chemistry, Vol. 279, Issue 45, pp. 47242-53, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183775
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top