Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183775

ERGIC and Golgi 2 (ERGIC2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Erv41, PTX1, cd002, Ptx1, AA408438, 1200009B18Rik, 4930572C01Rik, RGD1310606, zgc:64005, ptx1, MGC75899
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183775
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ERGIC2 antibody: synthetic peptide directed towards the N terminal of human ERGIC2
Sequence MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIA FTTMALLTIM
Predicted Reactivity Bovine : 100%, Chicken : 100%, Human : 100%, African clawed frog : 92%, Dog : 92%, Mouse : 92%, Pig : 92%, Rat : 92%, Guinea pig : 86%
Characteristics This is a rabbit polyclonal antibody against ERGIon Channel2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ERGIC2
Background ERGIon Channel2 possibly play role in transport between endoplasmic reticulum and Golgi. ERGIon Channel2 is downregulated in prostate cancer. ERGIon Channel2 may play an important role in the growth and tumorigenicity of PC-3 prostate tumor cells. Ectopic expression of a partial sequence of ERGIon Channel2 as a VP22-fusion protein in prostate cancer cell line, PC-3, induced cellular senescence. Interferon-beta (IFN-beta) and a number of IFN-inducible genes were upregulated by the ERGIon Channel2-VP22 fusion protein.
Molecular Weight 43kDa
Gene ID 51290
NCBI Accession NP_057654, NM_016570
UniProt Q96RQ1
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ERGIC2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Breuza, Halbeisen, Jenö et al.: "Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46." in: The Journal of biological chemistry, Vol. 279, Issue 45, pp. 47242-53, 2004 (PubMed).

Alternatives for antigen "ERGIC and Golgi 2 (ERGIC2)", type "Antibodies"
Hosts (13)
Reactivities (12), (6), (4), (2), (2), (1), (1)
Applications (13), (4), (2)
Epitopes (4), (3), (2), (2), (2), (2)
Beacon