Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183790

Unconventional SNARE in The ER 1 Homolog (S. Cerevisiae) (Use1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms D12, Ed2, p31, Q-snare, AV002165, 2010315L10Rik, 5730403H22Rik, fj43b06, wu:fj43b06, zgc:56402, RGD1306660, CG14181, Dmel\\CG14181, FBgn 35965, P31, SLT1, GB16719
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183790
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MDS032 antibody: synthetic peptide directed towards the N terminal of human MDS032
Sequence ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQAL KVHASKPASE
Predicted Reactivity Bovine :100%,   Human :100%,   Rat :92%,   Mouse :92%,   Dog :92%,   Chicken :85%,   Grape :76%,   Zebrafish :76%,  
Characteristics This is a rabbit polyclonal antibody against MDS032. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name MDS032
Background MDS032 belongs to the USE1 family and is a component of a SNARE complex which may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER.
Molecular Weight 29kDa
Gene ID 55850
NCBI Accession NP_060937, NM_018467
UniProt Q9NZ43
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MDS032 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Matsuda, Suzuki, Honda et al.: "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways." in: Oncogene, Vol. 22, Issue 21, pp. 3307-18, 2003 (PubMed).

Alternatives for antigen "Unconventional SNARE in The ER 1 Homolog (S. Cerevisiae) (Use1)", type "Antibodies"
Hosts (30), (3)
Reactivities (24), (22), (15), (15), (15), (12), (3), (2), (1)
Applications (24), (10), (7), (6), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (3), (3), (2), (1), (1)
Beacon