Did you know that you can buy products from over 140 different suppliers from us?

Unconventional SNARE in The ER 1 Homolog (S. Cerevisiae) (Use1) (N-Term) antibody

Details for Product No. ABIN183790
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms D12, Ed2, p31, Q-snare, AV002165, 2010315L10Rik, 5730403H22Rik, fj43b06, wu:fj43b06, zgc:56402, RGD1306660, CG14181, Dmel\\CG14181, FBgn 35965, P31, SLT1, GB16719
Epitope
N-Term
(14), (7), (3), (3), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(31), (24), (16), (15), (15), (12), (3), (2), (1)
Host
Rabbit
(37), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(31), (11), (10), (6), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183790
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MDS032
Sequence ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQAL KVHASKPASE
Predicted Reactivity Bovine :100 %,   Human :100 %,   Rat :90 %,   Mouse :90 %,   Dog :90 %,   Chicken :80 %,   Grape :70 %,   Zebrafish :70 %,  
Characteristics This is a rabbit polyclonal antibody against MDS032. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name MDS032
Background MDS032 belongs to the USE1 family and is a component of a SNARE complex which may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER.
Molecular Weight 29 kDa
Gene ID 55850
NCBI Accession NM_018467, NP_060937
UniProt Q9NZ43
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 259 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Unconventional SNARE in The ER 1 Homolog (S. Cerevisiae) (Use1) (N-Term) antibody WB Suggested Anti-MDS032 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
anti-Unconventional SNARE in The ER 1 Homolog (S. Cerevisiae) (Use1) (N-Term) antibody (2) anti-Unconventional SNARE in The ER 1 Homolog (S. Cerevisiae) (Use1) (N-Term) antibody (Image 2)
Background publications Matsuda, Suzuki, Honda et al.: "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways." in: Oncogene, Vol. 22, Issue 21, pp. 3307-18, 2003 (PubMed).

Hosts (37), (3)
Reactivities (31), (24), (16), (15), (15), (12), (3), (2), (1)
Applications (31), (11), (10), (6), (3), (2)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (14), (7), (3), (3), (2), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183790
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top