Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183828

Zinc Finger Protein 496 (ZNF496) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NIZP1, ZFP496, ZKSCAN17, ZSCAN49, Zkscan17, Znf496, ZNF496
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183828
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF496 antibody: synthetic peptide directed towards the N terminal of human ZNF496
Sequence MPTALCPRVLAPKESEEPRKMRSPPGENPSPQGELPSPES SRRLFRRFRY
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Pig : 100%, Sheep : 100%, Guinea pig : 92%
Characteristics This is a rabbit polyclonal antibody against ZNF496. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZNF496
Background ZNF496 contains a SCAN box, a KRAB-A domain, and four consensus C2H2-type zinc fingers preceded by a unique finger derivative, referred to herein as the C2HR motif. The C2HR motif functions to mediate protein-protein interaction with the cysteine-rich (C5HCH) domain of NSD1 in a Zn(II)-dependent fashion, and when tethered to RNA polymerase II promoters, represses transcription in an NSD1-dependent manner. ZNF496 contains a novel type of zinc finger motif that functions as a docking site for NSD1 and is more than just a degenerate evolutionary remnant of a C2H2 motif.
Molecular Weight 67kDa
Gene ID 84838
NCBI Accession NP_116141, NM_032752
UniProt Q96IT1
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF496 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 496 (ZNF496)", type "Antibodies"
Hosts (8), (7)
Reactivities (14), (5), (2), (2)
Applications (15), (6), (6), (2), (1), (1), (1)
Epitopes (3), (3), (2), (1), (1)
Beacon