Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 496 (ZNF496) (N-Term) antibody

Details for Product No. ABIN183828
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Zkscan17, Znf496, ZNF496, NIZP1, ZFP496, ZKSCAN17, ZSCAN49, BC040205, D130067D09, Nizp1, Zfp496
Epitope
N-Term
(8), (3), (3), (3), (2), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Cow (Bovine), Human
(23), (5), (2), (2)
Host
Rabbit
(13), (12)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(24), (12), (6), (6), (2), (2), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183828
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF496
Sequence MPTALCPRVLAPKESEEPRKMRSPPGENPSPQGELPSPES SRRLFRRFRY
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Pig : 100 %, Sheep : 100 %, Guinea pig : 90 %
Characteristics This is a rabbit polyclonal antibody against ZNF496. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ZNF496
Background ZNF496 contains a SCAN box, a KRAB-A domain, and four consensus C2H2-type zinc fingers preceded by a unique finger derivative, referred to herein as the C2HR motif. The C2HR motif functions to mediate protein-protein interaction with the cysteine-rich (C5HCH) domain of NSD1 in a Zn(II)-dependent fashion, and when tethered to RNA polymerase II promoters, represses transcription in an NSD1-dependent manner. ZNF496 contains a novel type of zinc finger motif that functions as a docking site for NSD1 and is more than just a degenerate evolutionary remnant of a C2H2 motif.
Molecular Weight 67 kDa
Gene ID 84838
NCBI Accession NM_032752, NP_116141
UniProt Q96IT1
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 587 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 496 (ZNF496) (N-Term) antibody WB Suggested Anti-ZNF496 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
anti-Zinc Finger Protein 496 (ZNF496) (N-Term) antibody (2) WB Suggested Anti-ZNF496
Antibody Titration: 1.25 µg/mL ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Validation Images
back to top