Male-Specific Lethal 3 Homolog (Drosophila) (MSL3) (C-Term) antibody

Details for Product No. ABIN183843
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms MSL3L1, AU018931, Msl31, Msl3l1, msl3l1, MSL3
Epitope
C-Term
(4), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
(10), (4), (4), (2), (2)
Host
Rabbit
(10)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (2)
Pubmed 1 reference available
Catalog no. ABIN183843
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human MSL3L1
Sequence FSEKNLKALLKHFDLFLRFLAEYHDDFFPESAYVAACEAH YSTKNPRAIY
Predicted Reactivity Human :100 %,   Sumatran orangutan :100 %,   Dog :100 %,   Bovine :100 %,   Rat :100 %,   Mouse :100 %,   White-tufted-ear marmoset :80 %,   Western clawed frog :80 %,   African clawed frog :70 %,  
Characteristics This is a rabbit polyclonal antibody against MSL3L1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name MSL3L1
Background MSL3L1 is a nuclear protein, which is thought to play a similar function in chromatin remodeling and transcriptional regulation. This gene has been found to undergo X inactivation.
Molecular Weight 41 kDa
Gene ID 10943
NCBI Accession NM_006800, NP_006791
UniProt Q5T295
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 355 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Hosts (10)
Reactivities (10), (4), (4), (2), (2)
Applications (10), (2)
Epitopes (4), (2), (1), (1), (1), (1)
back to top