Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183843

Male-Specific Lethal 3 Homolog (Drosophila) (MSL3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MSL3L1, AU018931, Msl31, Msl3l1, msl3l1, MSL3
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183843
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MSL3L1 antibody: synthetic peptide directed towards the C terminal of human MSL3L1
Sequence FSEKNLKALLKHFDLFLRFLAEYHDDFFPESAYVAACEAH YSTKNPRAIY
Predicted Reactivity Human :100%,   Sumatran orangutan :100%,   Dog :100%,   Bovine :100%,   Rat :100%,   Mouse :100%,   White-tufted-ear marmoset :84%,   Western clawed frog :84%,   African clawed frog :76%,  
Characteristics This is a rabbit polyclonal antibody against MSL3L1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name MSL3L1
Background MSL3L1 is a nuclear protein, which is thought to play a similar function in chromatin remodeling and transcriptional regulation. This gene has been found to undergo X inactivation.
Molecular Weight 41kDa
Gene ID 10943
NCBI Accession NP_006791, NM_006800
UniProt Q5T295
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MSL3L1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives for antigen "Male-Specific Lethal 3 Homolog (Drosophila) (MSL3)", type "Antibodies"
Hosts (10), (2)
Reactivities (12), (6), (6), (2), (2)
Applications (12), (3), (2), (2)
Epitopes (5), (2), (2), (1), (1), (1), (1)
Beacon