Did you know that you can buy products from over 140 different suppliers from us?

Obg-Like ATPase 1 (OLA1) (N-Term) antibody

Details for Product No. ABIN183916
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
DOC45, GBP45, GTBP9, GTPBP9, PTD004, RGD1307982, 2510025G09Rik, 2810405J23Rik, 2810409H07Rik, Gtpbp9, fe36h01, zgc:55768, zgc:85691, wu:fc66b09, wu:fe36h01, wu:fk82a02, MGC54033, MGC79585, DKFZp469M10 ... show more
DOC45, GBP45, GTBP9, GTPBP9, PTD004, RGD1307982, 2510025G09Rik, 2810405J23Rik, 2810409H07Rik, Gtpbp9, fe36h01, zgc:55768, zgc:85691, wu:fc66b09, wu:fe36h01, wu:fk82a02, MGC54033, MGC79585, DKFZp469M1031 show less
Epitope
N-Term
(14), (8), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
(36), (19), (19), (15), (14), (2), (1), (1), (1)
Host
Rabbit
(40)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(31), (14), (10), (8), (3), (3)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183916
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GTPBP9
Sequence MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKK PVRFYHDWND
Predicted Reactivity Rat :100 %,   Human :100 %,   African clawed frog :100 %,   Western clawed frog :100 %,   Chicken :100 %,   Sumatran orangutan :100 %,   Green puffer :100 %,   Bovine :100 %,   Mouse :100 %,   Atlantic salmon :90 %,   Rainbow smelt :90 %,   Zebrafish :90 %,   Fruit fly :80 %,   Argulus sp. Arg2 :80 %,   Southern house mosquito :70 %,   Pea aphid :70 %,   Hanseniella sp. 'Han2' :70 %,   Orchesella imitari :70 %,   Tomocerus sp. 'Tom2' :70 %,   Savannah tsetse fly :70 %,   African malaria mosquito :70 %,   Giant whipscorpion :70 %,  
Characteristics This is a rabbit polyclonal antibody against GTPBP9. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name GTPBP9
Background GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.
Molecular Weight 44 kDa
Gene ID 29789
NCBI Accession NM_013341, NP_037473
UniProt Q9NTK5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 396 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Obg-Like ATPase 1 (OLA1) (N-Term) antibody WB Suggested Anti-GTPBP9 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
anti-Obg-Like ATPase 1 (OLA1) (N-Term) antibody (2) anti-Obg-Like ATPase 1 (OLA1) (N-Term) antibody (Image 2)
Background publications Wiemann, Weil, Wellenreuther et al.: "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs...." in: Genome research, Vol. 11, Issue 3, pp. 422-35, 2001 (PubMed).

Hosts (40)
Reactivities (36), (19), (19), (15), (14), (2), (1), (1), (1)
Applications (31), (14), (10), (8), (3), (3)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (14), (8), (2), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183916
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top