Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183916

Obg-Like ATPase 1 (OLA1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
DOC45, GBP45, GTBP9, GTPBP9, PTD004, RGD1307982, 2510025G09Rik, 2810405J23Rik, 2810409H07Rik, Gtpbp9, fe36h01, zgc:55768, zgc:85691, wu:fc66b09, wu:fe36h01, wu:fk82a02, MGC54033, MGC79585, DKFZp469M10 ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183916
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the N terminal of human GTPBP9
Sequence MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKK PVRFYHDWND
Predicted Reactivity Rat :100%,   Human :100%,   African clawed frog :100%,   Western clawed frog :100%,   Chicken :100%,   Sumatran orangutan :100%,   Green puffer :100%,   Bovine :100%,   Mouse :100%,   Atlantic salmon :92%,   Rainbow smelt :92%,   Zebrafish :92%,   Fruit fly :85%,   Argulus sp. Arg2 :85%,   Southern house mosquito :78%,   Pea aphid :78%,   Hanseniella sp. 'Han2' :78%,   Orchesella imitari :78%,   Tomocerus sp. 'Tom2' :78%,   Savannah tsetse fly :78%,   African malaria mosquito :78%,   Giant whipscorpion :78%,  
Characteristics This is a rabbit polyclonal antibody against GTPBP9. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name GTPBP9
Background GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.
Molecular Weight 44kDa
Gene ID 29789
NCBI Accession NP_037473, NM_013341
UniProt Q9NTK5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GTPBP9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wiemann, Weil, Wellenreuther et al.: "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." in: Genome research, Vol. 11, Issue 3, pp. 422-35, 2001 (PubMed).

Alternatives for antigen "Obg-Like ATPase 1 (OLA1)", type "Antibodies"
Hosts (32)
Reactivities (28), (18), (18), (15), (14), (2), (1), (1), (1)
Applications (23), (10), (7), (7), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (2), (2), (1)
Beacon