Obg-Like ATPase 1 (OLA1) (N-Term) antibody

Details for Product No. ABIN183916, Supplier: Login to see New
New
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(23), (16), (2), (1), (1), (1), (1)
Reactivity
Chicken, Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio)
(65), (29), (29), (9), (4), (4), (3), (2), (2), (2)
Host
Rabbit
(65)
Clonality
Polyclonal
Conjugate
Un-conjugated
(5), (5), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(54), (26), (14), (11), (7), (5), (3), (1), (1)
Pubmed 1 reference available
ProductDetails: Supplier Login to see New
ProductDetails: Supplier Product Number Login to see New
Quantity 100 μg
Options
Shipping to United States ( )
Availability Please contact our customer support.
Immunogen Synthetic peptide directed towards the N terminal of human GTPBP9
Sequence MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKK PVRFYHDWND
Predicted Reactivity Rat :100 %,   Human :100 %,   African clawed frog :100 %,   Western clawed frog :100 %,   Chicken :100 %,   Sumatran orangutan :100 %,   Green puffer :100 %,   Bovine :100 %,   Mouse :100 %,   Atlantic salmon :90 %,   Rainbow smelt :90 %,   Zebrafish :90 %,   Fruit fly :80 %,   Argulus sp. Arg2 :80 %,   Southern house mosquito :70 %,   Pea aphid :70 %,   Hanseniella sp. 'Han2' :70 %,   Orchesella imitari :70 %,   Tomocerus sp. 'Tom2' :70 %,   Savannah tsetse fly :70 %,   African malaria mosquito :70 %,   Giant whipscorpion :70 %,  
Characteristics This is a rabbit polyclonal antibody against GTPBP9. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name GTPBP9 (OLA1 Antibody Abstract)
Background GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.
Molecular Weight 44 kDa
Gene ID 29789
NCBI Accession NM_013341, NP_037473
UniProt Q9NTK5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 396 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
Western Blotting (WB) image for anti-Obg-Like ATPase 1 (OLA1) (N-Term) antibody (ABIN183916) WB Suggested Anti-GTPBP9 Antibody Titration: 1.25ug/ml
Positive Control:...
Immunohistochemistry (IHC) image for anti-Obg-Like ATPase 1 (OLA1) (N-Term) antibody (ABIN183916) anti-Obg-Like ATPase 1 (OLA1) (N-Term) antibody (Image 2)
Background publications Wiemann, Weil, Wellenreuther et al.: "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. ..." in: Genome research, Vol. 11, Issue 3, pp. 422-35, 2001 (PubMed).

Catalog No. ABIN183916
$229.00
Plus shipping costs $45.00
Add to Basket

Order hotline:

  • +1 877 302 8632
  • +1 888 205 9894 (TF)
Did you look for something else?