Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184075

Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2510028H02Rik, 2810036L13Rik, AI256697, AI852082, Hnrpll, HNRPLL, SRRF, RGD1305861, srrf
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184075
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HNRPLL antibody: synthetic peptide directed towards the N terminal of human HNRPLL
Sequence RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQP EAGGSHHKVS
Predicted Reactivity Bovine : 100%, Human : 100%, Rabbit : 100%, Guinea pig : 92%
Characteristics This is a rabbit polyclonal antibody against HNRPLL. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name HNRPLL
Background HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.
Molecular Weight 60kDa
Gene ID 92906
NCBI Accession NP_612403, NM_138394
UniProt Q8WVV9
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HNRPLL antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Shur, Ben-Avraham, Benayahu: "Alternatively spliced isoforms of a novel stromal RNA regulating factor." in: Gene, Vol. 334, pp. 113-21, 2004 (PubMed).

Alternatives for antigen "Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL)", type "Antibodies"
Hosts (14), (3)
Reactivities (15), (6), (6), (1)
Applications (15), (6), (2), (2)
Epitopes (7), (2), (1), (1)
Beacon