Did you know that you can buy products from over 140 different suppliers from us?

Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL) (N-Term) antibody

Details for Product No. ABIN184075
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2510028H02Rik, 2810036L13Rik, AI256697, AI852082, Hnrpll, HNRPLL, SRRF, RGD1305861, srrf
Epitope
N-Term
(10), (7), (2), (1)
Reactivity
Dog (Canine), Cow (Bovine), Human
(21), (8), (8), (1)
Host
Rabbit
(20), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(21), (13), (2), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN184075
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human HNRPLL
Sequence RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQP EAGGSHHKVS
Predicted Reactivity Bovine : 100 %, Human : 100 %, Rabbit : 100 %, Guinea pig : 90 %
Characteristics This is a rabbit polyclonal antibody against HNRPLL. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name HNRPLL
Background HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.
Molecular Weight 60 kDa
Gene ID 92906
NCBI Accession NM_138394, NP_612403
UniProt Q8WVV9
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 542 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL) (N-Term) antibody WB Suggested Anti-HNRPLL Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
anti-Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL) (N-Term) antibody (2) anti-Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL) (N-Term) antibody (Image 2)
anti-Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL) (N-Term) antibody (3) anti-Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL) (N-Term) antibody (Image 3)
Background publications Shur, Ben-Avraham, Benayahu: "Alternatively spliced isoforms of a novel stromal RNA regulating factor." in: Gene, Vol. 334, pp. 113-21, 2004 (PubMed).

Hosts (20), (3)
Reactivities (21), (8), (8), (1)
Applications (21), (13), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (10), (7), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184075
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top