Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309622

Ets Variant 5 (ETV5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ERM, 1110005E01Rik, 8430401F14Rik, etv5, fj87h10, id:ibd5133, wu:fj87h10, zgc:55647
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309622
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ETV5 antibody: synthetic peptide directed towards the N terminal of human ETV5
Sequence MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLA HDSEELFQDL
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Rat : 92%, Mouse : 91%, Chicken : 81%
Characteristics This is a rabbit polyclonal antibody against ETV5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ETV5
Background ETV5 Contains 1 ETS DNA-binding domain and belongs to the ETS family. The ETV5 gene expression is regulated by the conventional PKC (cPKC) pathway.ETV5 is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity Phosphorylated ETV5 and the actin cytoskeleton regulate CD44-mediated hyaluronan binding in myeloid cells. ERMs (ezrin/radixin/moesin) function as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases. ETV5 can cooperate with c-Jun and has a role in progression of breast cancer.
Molecular Weight 58kDa
Gene ID 2119
NCBI Accession NP_004445, NM_004454
UniProt P41161
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ETV5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Helgeson, Tomlins, Shah et al.: "Characterization of TMPRSS2:ETV5 and SLC45A3:ETV5 gene fusions in prostate cancer." in: Cancer research, Vol. 68, Issue 1, pp. 73-80, 2008 (PubMed).

Alternatives for antigen "Ets Variant 5 (ETV5)", type "Antibodies"
Hosts (27), (21)
Reactivities (48), (17), (17), (14), (14), (12), (2), (1), (1)
Applications (36), (24), (10), (5), (4), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (4), (2), (2), (2), (1)
Beacon