Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309637

PBX3 (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Pbx3b
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN309637
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PBX3 antibody: synthetic peptide directed towards the N terminal of human PBX3
Sequence SRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQ DIGDILHQIM
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Chicken : 92%, Zebrafish : 84%
Characteristics This is a rabbit polyclonal antibody against PBX3. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Background PBX3 is a transcriptional activator that binds the sequence 5'-ATCAATCAA-3'.
Molecular Weight 47kDa
Gene ID 5090
NCBI Accession NP_006186, NM_006195
UniProt P40426
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PBX3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Monica, Galili, Nourse et al.: "PBX2 and PBX3, new homeobox genes with extensive homology to the human proto-oncogene PBX1." in: Molecular and cellular biology, Vol. 11, Issue 12, pp. 6149-57, 1991 (PubMed).

Alternatives for antigen "PBX3", type "Antibodies"
Hosts (19), (9)
Reactivities (28), (15), (15), (12), (12), (12), (12)
Applications (19), (16), (10), (9), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (1), (1)
Beacon