Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309641

Zinc Finger Protein 296 (ZNF296) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZFP296, ZNF342
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN309641
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF342 antibody: synthetic peptide directed towards the middle region of human ZNF342
Sequence MSRRKAGSAPRRVEPAPAANPDDEMEMQDLVIELKPEPDA QPQQAPRLGP
Predicted Reactivity Dog :100%,   Human :100%,   Bovine :92%,   Mouse :84%,  
Characteristics This is a rabbit polyclonal antibody against ZNF342. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF342
Background ZNF342 contains 6 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. It may be involved in transcriptional regulation.
Molecular Weight 51kDa
Gene ID 162979
NCBI Accession NP_660331, NM_145288
UniProt Q8WUU4
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF342 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hong, Bollen, Costello: "The contribution of genetic and epigenetic mechanisms to gene silencing in oligodendrogliomas." in: Cancer research, Vol. 63, Issue 22, pp. 7600-5, 2003 (PubMed).

Hong, Hansen, Yan et al.: "Beta-glucan functions as an adjuvant for monoclonal antibody immunotherapy by recruiting tumoricidal granulocytes as killer cells." in: Cancer research, Vol. 63, Issue 24, pp. 9023-31, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 296 (ZNF296)", type "Antibodies"
Hosts (21), (1)
Reactivities (22), (15), (15), (12), (4)
Applications (13), (10), (5), (4), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (1), (1), (1)
Beacon