Zinc Finger and SCAN Domain Containing 20 (ZSCAN20) (Middle Region) antibody

Details for Product No. ABIN309697
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KOX29, ZNF31, ZFP-31, ZNF360, C130001F22, Zfp31, Zkscan20, RGD1562996, ZSCAN20
Epitope
Middle Region
(6), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(17), (3), (1), (1)
Host
Rabbit
(10), (7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(16), (4), (4), (2)
Pubmed 1 reference available
Catalog no. ABIN309697
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZSCAN20
Sequence QESSSEEDLEKLIDHQGLYLAEKPYKCDTCMKSFSRSSHF IAHQRIHTGE
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against ZSCAN20. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZSCAN20
Background ZSCAN20 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 10 C2H2-type zinc fingers and 1 SCAN box domain. ZSCAN20 may be involved in transcriptional regulation.
Molecular Weight 117 kDa
Gene ID 7579
NCBI Accession NM_145238, NP_660281
UniProt P17040
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1043 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger and SCAN Domain Containing 20 (ZSCAN20) (Middle Region) antibody WB Suggested Anti-ZSCAN20 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Background publications Jordanova, Irobi, Thomas et al.: "Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy." in: Nature genetics, Vol. 38, Issue 2, pp. 197-202, 2006 (PubMed).

Hosts (10), (7)
Reactivities (17), (3), (1), (1)
Applications (16), (4), (4), (2)
Epitopes (6), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top