Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309697

Zinc Finger and SCAN Domain Containing 20 (ZSCAN20) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KOX29, ZNF31, ZFP-31, ZNF360, C130001F22, Zfp31, Zkscan20, RGD1562996, ZSCAN20
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309697
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZSCAN20 antibody: synthetic peptide directed towards the middle region of human ZSCAN20
Sequence QESSSEEDLEKLIDHQGLYLAEKPYKCDTCMKSFSRSSHF IAHQRIHTGE
Predicted Reactivity Bovine : 100%, Horse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against ZSCAN20. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZSCAN20
Background ZSCAN20 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 10 C2H2-type zinc fingers and 1 SCAN box domain. ZSCAN20 may be involved in transcriptional regulation.
Molecular Weight 117kDa
Gene ID 7579
NCBI Accession NP_660281, NM_145238
UniProt P17040
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZSCAN20 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Jordanova, Irobi, Thomas et al.: "Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy." in: Nature genetics, Vol. 38, Issue 2, pp. 197-202, 2006 (PubMed).

Alternatives for antigen "Zinc Finger and SCAN Domain Containing 20 (ZSCAN20)", type "Antibodies"
Hosts (7), (7)
Reactivities (14), (2), (1), (1)
Applications (14), (6), (3)
Epitopes (6), (2), (2), (1), (1)
Beacon