Did you know that you can buy products from over 140 different suppliers from us?

Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3) (C-Term) antibody

Details for Product No. ABIN309705
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AA209988, AI551208, CAR, CAR-beta, Care2, ESTM32, MB67, CAR1, CXR
Epitope
C-Term
(11), (9), (7), (4), (3), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Human
(40), (13), (8), (4), (3), (2), (1), (1), (1)
Host
Rabbit
(46), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(47), (24), (11), (6), (4), (3), (1), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309705
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human NR1I3
Sequence FHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQL QEEMALTLQS
Predicted Reactivity Human : 100 %, Mouse : 90 %, Rabbit : 90 %, Rat : 90 %, Guinea pig : 80 %, Dog : 70 %
Characteristics This is a rabbit polyclonal antibody against NR1I3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name NR1I3
Background NR1I3 is a member of the nuclear receptor superfamily, and is a key regulator of xenobiotic and endobiotic metabolism. The protein binds to DNA as a monomer or a heterodimer with the retinoid X receptor and regulates the transcription of target genes involved in drug metabolism and bilirubin clearance, such as cytochrome P450 family members.
Molecular Weight 40 kDa
Gene ID 9970
NCBI Accession NM_005122, NP_005113
UniProt Q5VTW5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 348 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3) (C-Term) antibody WB Suggested Anti-NR1I3 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Background publications Ferguson, Chen, LeCluyse et al.: "Human CYP2C8 is transcriptionally regulated by the nuclear receptors constitutive androstane receptor, pregnane X receptor, glucocorticoid receptor, and hepatic nuclear factor 4alpha." in: Molecular pharmacology, Vol. 68, Issue 3, pp. 747-57, 2005 (PubMed).

Validation Images
back to top