Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309738

Zinc Finger Protein 498 (ZNF498) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF498, Znf498
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN309738
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF498 antibody: synthetic peptide directed towards the middle region of human ZNF498
Sequence QIDCFGEYVEPQDCRVSPGGGSKEKEAKPPQEDLKGALVA LTSERFGEAS
Predicted Reactivity Human : 100%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against ZNF498. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name ZNF498
Background The function of ZNF498 remains unknown. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions. Alternative splicing results in two transcript variants encoding different proteins. Additional splice variants have been identified, but their biological validity has not been determinedThis gene encodes a protein of unknown function. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions.
Molecular Weight 35kDa
Gene ID 221785
NCBI Accession NP_660090, NM_145115
UniProt Q14C99
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF498 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Demena, Abdulkadir, Jorge: "Radioiodine treatment of hyperthyroidism at the Tikur Anbessa Hospital." in: Ethiopian medical journal, Vol. 39, Issue 1, pp. 39-46, 2001 (PubMed).

Background publications Laity, Lee, Wright: "Zinc finger proteins: new insights into structural and functional diversity." in: Current opinion in structural biology, Vol. 11, Issue 1, pp. 39-46, 2001 (PubMed).

Alternatives for antigen "Zinc Finger Protein 498 (ZNF498)", type "Antibodies"
Hosts (24), (1)
Reactivities (25), (2), (2)
Applications (25), (12), (1), (1), (1)
Epitopes (6), (5), (2), (2), (1), (1), (1), (1)
Beacon