Zinc Finger Protein 498 (ZNF498) (Middle Region) antibody

Details for Product No. ABIN309738
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ZNF498, Znf498
Epitope
Middle Region
(7), (6), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(31), (2), (2)
Host
Rabbit
(30), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(31), (16), (1), (1), (1)
Pubmed 2 references available
Catalog no. ABIN309738
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF498
Sequence QIDCFGEYVEPQDCRVSPGGGSKEKEAKPPQEDLKGALVA LTSERFGEAS
Predicted Reactivity Human : 100 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against ZNF498. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name ZNF498
Background The function of ZNF498 remains unknown. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions. Alternative splicing results in two transcript variants encoding different proteins. Additional splice variants have been identified, but their biological validity has not been determinedThis gene encodes a protein of unknown function. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions.
Molecular Weight 35 kDa
Gene ID 221785
NCBI Accession NM_145115, NP_660090
UniProt Q14C99
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 310 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 498 (ZNF498) (Middle Region) antibody WB Suggested Anti-ZNF498 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
anti-Zinc Finger Protein 498 (ZNF498) (Middle Region) antibody (2) anti-Zinc Finger Protein 498 (ZNF498) (Middle Region) antibody (Image 2)
Product cited in: Demena, Abdulkadir, Jorge: "Radioiodine treatment of hyperthyroidism at the Tikur Anbessa Hospital." in: Ethiopian medical journal, Vol. 39, Issue 1, pp. 39-46, 2001 (PubMed).

Background publications Laity, Lee, Wright: "Zinc finger proteins: new insights into structural and functional diversity." in: Current opinion in structural biology, Vol. 11, Issue 1, pp. 39-46, 2001 (PubMed).

Hosts (30), (1)
Reactivities (31), (2), (2)
Applications (31), (16), (1), (1), (1)
Epitopes (7), (6), (2), (2), (1), (1), (1), (1), (1)
back to top