Did you know that you can buy products from over 140 different suppliers from us?

Homeobox C9 (HOXC9) (Middle Region) antibody

Details for Product No. ABIN309792
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms bz39, BZ-39, hoxc9, zgc:109844, hox3, hox3b, Xhoxc9, HOXC9, HOX3, HOX3B, Hox-3.2, Hoxc8, HOXC8, HOXC-9
Epitope
Middle Region
(7), (7), (4), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(27), (24), (13), (11), (1)
Host
Rabbit
(28), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(26), (9), (9), (2), (2), (2), (1), (1)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309792
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HOXC9
Sequence DRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHAR STRKKRCPYT
Predicted Reactivity Goat : 100 %, Human : 100 %, Rat : 100 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against HOXC9. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name HOXC9
Background HOXC9 belongs to the homeobox family. The homeobox family is a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12.
Molecular Weight 29 kDa
Gene ID 3225
NCBI Accession NM_006897, NP_008828
UniProt P31274
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 260 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Homeobox C9 (HOXC9) (Middle Region) antibody anti-Homeobox C9 (HOXC9) (Middle Region) antibody
anti-Homeobox C9 (HOXC9) (Middle Region) antibody (2) WB Suggested Anti-HOXC9
Antibody Titration: 2.5 µg/mL
Positive Control: Transfected 293T
Product cited in: Hur, Lee, Yun et al.: "Analysis of HOX Gene Expression Patterns in Human Breast Cancer." in: Molecular biotechnology, 2013 (PubMed).

Background publications Kosaki, Kosaki, Suzuki et al.: "Complete mutation analysis panel of the 39 human HOX genes." in: Teratology, Vol. 65, Issue 2, pp. 50-62, 2002 (PubMed).

Validation Images
back to top