Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309816

Zinc Finger Protein 596 (ZNF596) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF596
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309816
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF596 antibody: synthetic peptide directed towards the C terminal of human ZNF596
Sequence AFNRSYNFRLHRRVHTGEKPYVCPLCGKAFSKFFNLRQHE RTHTKKAMNM
Predicted Reactivity Bovine :100%,   Zebrafish :100%,   Black-legged tick :90%,   Chicken :90%,   Human :100%,   Southern house mosquito :81%,   Body louse :81%,  
Characteristics This is a rabbit polyclonal antibody against ZNF596. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF596
Background ZNF596 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 58kDa
Gene ID 169270
NCBI Accession NP_775810, NM_173539
UniProt Q8TC21
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF596 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nusbaum, Mikkelsen, Zody et al.: "DNA sequence and analysis of human chromosome 8." in: Nature, Vol. 439, Issue 7074, pp. 331-5, 2006 (PubMed).

Alternatives for antigen "Zinc Finger Protein 596 (ZNF596)", type "Antibodies"
Hosts (15), (5)
Reactivities (20), (1)
Applications (17), (8), (5), (3), (2), (1), (1), (1)
Epitopes (3), (3), (1)
Beacon