Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309931

CXXC Finger Protein 1 (CXXC1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2410002I16Rik, 5830420C16Rik, CFP1, CGBP, HsT2645, PCCX1, PHF18, SPP1, ZCGPC1, hCGBP, Cfp1, Cgbp, AI426635, LWS-2, opn1lw2, zgc:55527
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309931
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CXXC1 antibody: synthetic peptide directed towards the C terminal of human CXXC1
Sequence RVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPL TTDLRSSADR
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 92%, Bovine : 85%, Goat : 85%
Characteristics This is a rabbit polyclonal antibody against CXXC1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CXXC1
Background Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression.Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression (Carlone and Skalnik, 2001).
Molecular Weight 76kDa
Gene ID 30827
NCBI Accession NP_055408, NM_014593
UniProt Q9P0U4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CXXC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lee, Skalnik: "CpG-binding protein (CXXC finger protein 1) is a component of the mammalian Set1 histone H3-Lys4 methyltransferase complex, the analogue of the yeast Set1/COMPASS complex." in: The Journal of biological chemistry, Vol. 280, Issue 50, pp. 41725-31, 2005 (PubMed).

Alternatives for antigen "CXXC Finger Protein 1 (CXXC1)", type "Antibodies"
Hosts (16)
Reactivities (15), (7), (5), (1), (1), (1)
Applications (14), (4)
Epitopes (2), (2), (2), (2), (2), (1), (1), (1)
Beacon