Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310066

KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Sam68, p62, p68, P62, fj90g10, khdrbs1, wu:fa18g12, wu:fa56c01, wu:fc91b01, wu:fj90g10, zgc:113899, KHDRBS1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310066
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KHDRBS1 antibody: synthetic peptide directed towards the N terminal of human KHDRBS1
Sequence LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEE NYLDLFSHKN
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against KHDRBS1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KHDRBS1
Background KHDRBS1 recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. KHDRBS1 play a role in G2-M progression in the cell cycle. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export.
Molecular Weight 48kDa
Gene ID 10657
NCBI Accession NP_006550, NM_006559
UniProt Q07666
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KHDRBS1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Duran, Linares, Galvez et al.: "The signaling adaptor p62 is an important NF-kappaB mediator in tumorigenesis." in: Cancer cell, Vol. 13, Issue 4, pp. 343-54, 2008 (PubMed).

Alternatives for antigen "KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1)", type "Antibodies"
Hosts (48), (6), (2)
Reactivities (50), (26), (23), (14), (13), (12), (12), (1)
Applications (44), (19), (16), (12), (10), (10), (8), (4), (4), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (4), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon