Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310073

Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CPSF160, P/cl.18, HSU37012, ATCPSF160, K17N15.21, K17N15_21, cleavage and polyadenylation specificity factor 160, CG10110, CPSF, CPSF-160, Cpsf, Dmel\\CG10110, anon-WO0118547.217, cpsf, dCPSF-160, wu: ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310073
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CPSF1 antibody: synthetic peptide directed towards the middle region of human CPSF1
Sequence GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGR RHGFLILSRE
Predicted Reactivity Human : 100%, Horse : 78%
Characteristics This is a rabbit polyclonal antibody against CPSF1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CPSF1
Background CPSF1 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.
Molecular Weight 161kDa
Gene ID 29894
NCBI Accession NP_037423, NM_013291
UniProt Q10570
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CPSF1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives for antigen "Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1)", type "Antibodies"
Hosts (7)
Reactivities (5), (3), (2)
Applications (5), (2), (2), (1), (1), (1), (1), (1)
Epitopes (1), (1)
Beacon