Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1) (Middle Region) antibody

Details for Product No. ABIN310073
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
CPSF160, P/cl.18, HSU37012, ATCPSF160, K17N15.21, K17N15_21, cleavage and polyadenylation specificity factor 160, CG10110, CPSF, CPSF-160, Cpsf, Dmel\\CG10110, anon-WO0118547.217, cpsf, dCPSF-160, wu: ... show more
CPSF160, P/cl.18, HSU37012, ATCPSF160, K17N15.21, K17N15_21, cleavage and polyadenylation specificity factor 160, CG10110, CPSF, CPSF-160, Cpsf, Dmel\\CG10110, anon-WO0118547.217, cpsf, dCPSF-160, wu:fb24c01, CPSF1, DKFZp469K0832 show less
Epitope
Middle Region
(1), (1)
Reactivity
Human
(4), (2), (2)
Host
Rabbit
(6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN310073
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CPSF1
Sequence GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGR RHGFLILSRE
Predicted Reactivity Human : 100 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against CPSF1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CPSF1
Background CPSF1 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.
Molecular Weight 161 kDa
Gene ID 29894
NCBI Accession NM_013291, NP_037423
UniProt Q10570
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1443 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Hosts (6)
Reactivities (4), (2), (2)
Applications (4), (2), (2)
Epitopes (1), (1)
back to top