Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310235

Methyltransferase Like 13 (METTL13) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5630401D24Rik, KIAA0859, feat, METTL13, cgi-01, kiaa0859, RGD1311526, si:dkey-19f21.2, zgc:152769
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310235
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KIAA0859 antibody: synthetic peptide directed towards the C terminal of human KIAA0859
Sequence NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDT YVLSDMLKTV
Predicted Reactivity Rat :100%,   Mouse :100%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against KIAA0859. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name KIAA0859
Background The function remains unknown.
Molecular Weight 60kDa
Gene ID 51603
NCBI Accession NP_001007240, NM_001007239
UniProt Q8N6R0-1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KIAA0859 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Methyltransferase Like 13 (METTL13)", type "Antibodies"
Hosts (3)
Reactivities (1), (1)
Applications (3)
Epitopes (1), (1)
Beacon