Methyltransferase Like 13 (METTL13) (C-Term) antibody

Details for Product No. ABIN310235
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5630401D24Rik, KIAA0859, feat, METTL13, cgi-01, kiaa0859, RGD1311526, si:dkey-19f21.2, zgc:152769
Epitope
C-Term
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(1), (1)
Host
Rabbit
(3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3)
Pubmed 1 reference available
Catalog no. ABIN310235
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human KIAA0859
Sequence NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDT YVLSDMLKTV
Predicted Reactivity Rat :100 %,   Mouse :100 %,   Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against KIAA0859. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name KIAA0859
Background The function remains unknown.
Molecular Weight 60 kDa
Gene ID 51603
NCBI Accession NM_001007239, NP_001007240
UniProt Q8N6R0-1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 543 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Methyltransferase Like 13 (METTL13) (C-Term) antibody WB Suggested Anti-KIAA0859 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Hosts (3)
Reactivities (1), (1)
Applications (3)
Epitopes (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top