Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310264

Dihydrolipoyl Transacetylase (DLAT) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 6332404G05Rik, DLTA, PDC-E2, DLAT, Dmel\\CG5261, EP(2)0816, EP816, anon-WO0118547.121, wu:fc14f10, wu:fc21f08, wu:fc86g11, wu:fj57d06, PDCE2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310264
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DLAT antibody: synthetic peptide directed towards the N terminal of human DLAT
Sequence WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLS PTMQAGTIAR
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, African clawed frog : 92%, Zebrafish : 85%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against DLAT. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name DLAT
Background DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.The DLAT gene encodes dihydrolipoamide acetyltransferase (EC 2.3.1.12), the E2 subunit of the mammalian pyruvate dehydrogenase complex (PDC, EC 1.2.4.1) of the inner mitochondrial membrane. Patients with primary biliary cirrhosis (PBC, MIM 109720) show autoantibodies to DLAT.
Molecular Weight 69kDa
Gene ID 1737
NCBI Accession NP_001922, NM_001931
UniProt P10515
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DLAT antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Head, Brown, Zolkipli et al.: "Clinical and genetic spectrum of pyruvate dehydrogenase deficiency: dihydrolipoamide acetyltransferase (E2) deficiency." in: Annals of neurology, Vol. 58, Issue 2, pp. 234-41, 2005 (PubMed).

Alternatives for antigen "Dihydrolipoyl Transacetylase (DLAT)", type "Antibodies"
Hosts (11), (5)
Reactivities (14), (4), (4), (2), (1), (1), (1), (1), (1), (1)
Applications (15), (5), (4), (3), (3), (2), (1), (1), (1)
Epitopes (5), (2), (1), (1), (1)
Beacon