Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310296

Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OSCP, TIED, B930011D01Rik, ITGBL1, MGC99074
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310296
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ITGBL1 antibody: synthetic peptide directed towards the N terminal of human ITGBL1
Sequence MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAAC RLSRAESERR
Predicted Reactivity Dog : 100%, Horse : 100%, Pig : 100%, Rat : 92%, Mouse : 85%
Characteristics This is a rabbit polyclonal antibody against ITGBL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ITGBL1
Background The function remains unknown.
Molecular Weight 54kDa
Gene ID 9358
NCBI Accession NP_004782, NM_004791
UniProt O95965
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ITGBL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Chumakov, Blumenfeld, Guerassimenko et al.: "Genetic and physiological data implicating the new human gene G72 and the gene for D-amino acid oxidase in schizophrenia." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 21, pp. 13675-80, 2002 (PubMed).

Alternatives for antigen "Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1)", type "Antibodies"
Hosts (9)
Reactivities (7), (1), (1), (1), (1)
Applications (9), (3), (3), (1), (1)
Epitopes (3), (2), (1), (1), (1), (1)
Beacon