Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310325

Family with Sequence Similarity 107, Member A (FAM107A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DRR1, TU3A, Drr1, RGD1306327, Tu3a, drr1, tu3a, xdrr1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310325
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM107A antibody: synthetic peptide directed towards the middle region of human FAM107A
Sequence RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVREN LRRIATLTSE
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Chicken : 92%, Horse : 92%, Pig : 92%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against FAM107A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name FAM107A
Background When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.
Molecular Weight 17kDa
Gene ID 11170
NCBI Accession NP_009108, NM_007177
UniProt O95990
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM107A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 107, Member A (FAM107A)", type "Antibodies"
Hosts (16), (2)
Reactivities (17), (14), (14), (12), (12), (12), (11), (1), (1), (1), (1)
Applications (9), (7), (5), (2), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1)
Beacon