BSD Domain Containing 1 (BSDC1) (N-Term) antibody

Details for Product No. ABIN310356
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms AW011758, 1110063F24Rik, RGD1311622, fb51h12, wu:fb51h12, zgc:100785, bsdc1, BSDC1
Epitope
N-Term
(4), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Zebrafish (Danio rerio)
(7)
Host
Rabbit
(7), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(8), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310356
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human BSDC1
Sequence VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLY SLQSDPATYC
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Dog : 90 %
Characteristics This is a rabbit polyclonal antibody against BSDC1. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name BSDC1
Background The function remains unknown.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Weight 17 kDa
Gene ID 55108
NCBI Accession NM_003347, NP_060515
UniProt Q9NW68-3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 154 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-BSD Domain Containing 1 (BSDC1) (N-Term) antibody WB Suggested Anti-BSDC1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Hosts (7), (1)
Reactivities (7)
Applications (8), (2), (1), (1)
Epitopes (4), (2), (2), (1)
back to top