Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310380

Family with Sequence Similarity 129, Member A (FAM129A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C1orf24, NIBAN, AI256368, AU019833, Niban
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310380
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM129A antibody: synthetic peptide directed towards the N terminal of human FAM129A
Sequence SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHF PDPLASSEKE
Predicted Reactivity Bovine : 85%, Horse : 85%, Pig : 85%, Rabbit : 85%, Mouse : 84%, Rat : 84%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against FAM129A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name FAM129A
Background FAM129A is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis and it is a novel tumor marker.
Molecular Weight 103kDa
Gene ID 116496
NCBI Accession NP_443198, NM_052966
UniProt Q9BZQ8
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM129A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Matsumoto, Fujii, Abe et al.: "A novel tumor marker, Niban, is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis." in: Human pathology, Vol. 37, Issue 12, pp. 1592-600, 2006 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 129, Member A (FAM129A)", type "Antibodies"
Hosts (36), (1)
Reactivities (36), (14), (14), (12)
Applications (28), (10), (8), (8), (6), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (2), (1), (1)
Beacon