Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310516

Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI853530, si:busm1-266f07.3, si:dz266f07.3, CAT-4, CAT4, HCAT3, VH, MGC83777, SLC7A4, MGC147458
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310516
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC7A4 antibody: synthetic peptide directed towards the middle region of human SLC7A4
Sequence GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFI VAAGSICAMN
Predicted Reactivity Guinea pig : 100%, Mouse : 100%, Rat : 100%, Bovine : 85%, Dog : 84%, Pig : 84%, Horse : 78%
Characteristics This is a rabbit polyclonal antibody against SLC7A4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SLC7A4
Background SLC7A4 is involved in the transport of the cationic amino acids (arginine, lysine and ornithine).
Molecular Weight 68kDa
Gene ID 6545
NCBI Accession NP_004164, NM_004173
UniProt O43246
Research Area Signaling, Metabolism, Amino Acids
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC7A4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4)", type "Antibodies"
Hosts (17)
Reactivities (16)
Applications (15), (11), (2), (1), (1), (1)
Epitopes (9), (2), (1), (1)
Beacon