Did you know that you can buy products from over 140 different suppliers from us?

Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4) (Middle Region) antibody

Details for Product No. ABIN310516
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI853530, si:busm1-266f07.3, si:dz266f07.3, CAT-4, CAT4, HCAT3, VH, MGC83777, SLC7A4, MGC147458
Epitope
Middle Region
(10), (3), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
(20)
Host
Rabbit
(21)
Clonality
Polyclonal
Application
Western Blotting (WB)
(19), (14), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310516
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SLC7A4
Sequence GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFI VAAGSICAMN
Predicted Reactivity Guinea pig : 100 %, Mouse : 100 %, Rat : 100 %, Bovine : 80 %, Dog : 80 %, Pig : 80 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against SLC7A4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SLC7A4
Background SLC7A4 is involved in the transport of the cationic amino acids (arginine, lysine and ornithine).
Molecular Weight 68 kDa
Gene ID 6545
NCBI Accession NM_004173, NP_004164
UniProt O43246
Research Area Signaling, Metabolism, Amino Acids
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 635 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4) (Middle Region) antibody WB Suggested Anti-SLC7A4 Antibody Titration: 0.125ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Hosts (21)
Reactivities (20)
Applications (19), (14), (2), (1), (1), (1)
Epitopes (10), (3), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310516
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top