Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310521

Solute Carrier Family 35 (UDP-N-Acetylglucosamine (UDP-GlcNAc) Transporter), Member A3 (SLC35A3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310050P13Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310521
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC35A3 antibody: synthetic peptide directed towards the middle region of human SLC35A3
Sequence VAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAG VYFEKILKET
Predicted Reactivity Human : 100%, Rabbit : 93%, Bovine : 85%
Characteristics This is a rabbit polyclonal antibody against SLC35A3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SLC35A3
Background SLC35A3 is a uridine diphosphate-N-acetylglucosamine transporter in the Golgi apparatus.
Molecular Weight 36kDa
Gene ID 23443
NCBI Accession NP_036375, NM_012243
UniProt Q9Y2D2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC35A3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ghebranious, Burmester, Glurich et al.: "Evaluation of SLC35A3 as a candidate gene for human vertebral malformations." in: American journal of medical genetics. Part A, Vol. 140, Issue 12, pp. 1346-8, 2006 (PubMed).

Alternatives for antigen "Solute Carrier Family 35 (UDP-N-Acetylglucosamine (UDP-GlcNAc) Transporter), Member A3 (SLC35A3)", type "Antibodies"
Hosts (3), (2)
Reactivities (4)
Applications (5), (4)
Epitopes (2), (1)
Beacon