Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310551

Solute Carrier Family 25, Member 46 (SLC25A46) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI325987, 1200007B05Rik, RGD1305072, zgc:92767, slc25a46, SLC25A46, MGC152354
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Human, Zebrafish (Danio rerio), Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310551
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC25A46 antibody: synthetic peptide directed towards the N terminal of human SLC25A46
Sequence RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTS TPYEGPTEEP
Predicted Reactivity Human : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against SLC25A46. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name SLC25A46
Background SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.
Molecular Weight 46kDa
Gene ID 91137
NCBI Accession NP_620128, NM_138773
UniProt Q96AG3
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC25A46 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nishisho, Nakamura, Miyoshi et al.: "Mutations of chromosome 5q21 genes in FAP and colorectal cancer patients." in: Science (New York, N.Y.), Vol. 253, Issue 5020, pp. 665-9, 1991 (PubMed).

Alternatives for antigen "Solute Carrier Family 25, Member 46 (SLC25A46)", type "Antibodies"
Hosts (7)
Reactivities (5), (3), (3)
Applications (7), (3), (2)
Epitopes (2), (1)
Beacon