Did you know that you can buy products from over 140 different suppliers from us?

Solute Carrier Family 25, Member 46 (SLC25A46) (N-Term) antibody

Details for Product No. ABIN310551
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SLC25A46, MGC152354, zgc:92767, slc25a46, 1200007B05Rik, AI325987, RGD1305072
Epitope
N-Term
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Human, Zebrafish (Danio rerio), Chicken
(6), (4), (4)
Host
Rabbit
(8)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (3), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310551
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SLC25A46
Sequence RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTS TPYEGPTEEP
Predicted Reactivity Human : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against SLC25A46. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name SLC25A46
Background SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.
Molecular Weight 46 kDa
Gene ID 91137
NCBI Accession NM_138773, NP_620128
UniProt Q96AG3
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 418 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Solute Carrier Family 25, Member 46 (SLC25A46) (N-Term) antibody WB Suggested Anti-SLC25A46 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
anti-Solute Carrier Family 25, Member 46 (SLC25A46) (N-Term) antibody (2) WB Suggested Anti-SLC25A46
Antibody Titration: 5.0 µg/mL
Positive Control: Jurkat cell lysate
SLC25A46 is supported by BioGPS gene expression data to be expressed in Jurkat
Background publications Nishisho, Nakamura, Miyoshi et al.: "Mutations of chromosome 5q21 genes in FAP and colorectal cancer patients." in: Science (New York, N.Y.), Vol. 253, Issue 5020, pp. 665-9, 1991 (PubMed).

Validation Images
back to top