Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310698

Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CAR, CAR1, MB67, AA209988, AI551208, CAR-beta, Care2, ESTM32, CXR
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310698
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the N terminal of human NR1I3
Sequence MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVS KSIGPTCPFA
Predicted Reactivity Human : 100%, Mouse : 92%, Rat : 92%, Dog : 91%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against NR1I3. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name NR1I3
Background NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.
Molecular Weight 39kDa
Gene ID 9970
NCBI Accession NP_005113, NM_005122
UniProt Q5VTW5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NR1I3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ferguson, Chen, LeCluyse et al.: "Human CYP2C8 is transcriptionally regulated by the nuclear receptors constitutive androstane receptor, pregnane X receptor, glucocorticoid receptor, and hepatic nuclear factor 4alpha." in: Molecular pharmacology, Vol. 68, Issue 3, pp. 747-57, 2005 (PubMed).

Alternatives for antigen "Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3)", type "Antibodies"
Hosts (36), (1)
Reactivities (30), (12), (7), (4), (4), (2), (1), (1), (1)
Applications (37), (16), (8), (8), (3), (2)
Epitopes (7), (5), (4), (3), (2), (2), (1), (1), (1), (1)
Beacon