Protein O-Fucosyltransferase 2 (POFUT2) (N-Term) antibody

Details for Product No. ABIN310738
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FUT13, C21orf80, 2310011G23Rik, AI256847, BC003494, fc46a11, wu:fc46a11, zgc:194822
Epitope
N-Term
(2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Cow (Bovine), Human, Chicken
(20), (8), (2)
Host
Rabbit
(19), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (11), (7), (3), (3), (1)
Pubmed 2 references available
Catalog no. ABIN310738
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human POFUT2
Sequence GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTE EWVLVLPPWG
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Guinea pig : 100 %, Horse : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against POFUT2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name POFUT2
Background POFUT2 catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats. Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF, MIM 131530)-like repeats or thrombospondin (THBS, see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al., 2006 [PubMed 16464857]).
Molecular Weight 50 kDa
Gene ID 23275
NCBI Accession NM_133635, NP_598368
UniProt Q9Y2G5
Research Area Signaling, Metabolism, Organelles
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 429 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Luo, Koles, Vorndam et al.: "Protein O-fucosyltransferase 2 adds O-fucose to thrombospondin type 1 repeats." in: The Journal of biological chemistry, Vol. 281, Issue 14, pp. 9393-9, 2006 (PubMed).

Background publications Luo, Nita-Lazar, Haltiwanger: "Two distinct pathways for O-fucosylation of epidermal growth factor-like or thrombospondin type 1 repeats." in: The Journal of biological chemistry, Vol. 281, Issue 14, pp. 9385-92, 2006 (PubMed).

Hosts (19), (4)
Reactivities (20), (8), (2)
Applications (15), (11), (7), (3), (3), (1)
Epitopes (2), (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top