Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310741

Salt-Inducible Kinase 1 (SIK1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Sik, Snf1lk, MSK, SIK, SNF1LK, Msk, SIK2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310741
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SNF1LK antibody: synthetic peptide directed towards the N terminal of human SNF1LK
Sequence MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAV VKLARHRVTK
Predicted Reactivity Rat : 90%
Characteristics This is a rabbit polyclonal antibody against SNF1LK. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name SNF1LK
Background SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.
Molecular Weight 85kDa
Gene ID 150094
NCBI Accession NP_775490, NM_173354
UniProt P57059
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SNF1LK antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nishimura, Hayashi, Inada et al.: "Molecular cloning and characterization of mammalian homologues of vesicle-associated membrane protein-associated (VAMP-associated) proteins." in: Biochemical and biophysical research communications, Vol. 254, Issue 1, pp. 21-6, 1999 (PubMed).

Alternatives for antigen "Salt-Inducible Kinase 1 (SIK1)", type "Antibodies"
Hosts (43), (5)
Reactivities (46), (20), (19), (12), (12)
Applications (34), (24), (13), (10), (6), (4), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (5), (4), (3), (2), (2), (2), (1), (1), (1), (1)
Beacon