Salt-Inducible Kinase 1 (SIK1) (N-Term) antibody

Details for Product No. ABIN310741
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Sik, Snf1lk, MSK, SIK, SNF1LK, Msk, SIK2
Epitope
N-Term
(5), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Chicken
(42), (18), (17), (12), (12)
Host
Rabbit
(39), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(31), (23), (11), (10), (6), (5), (2)
Pubmed 1 reference available
Catalog no. ABIN310741
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SNF1LK
Sequence MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAV VKLARHRVTK
Predicted Reactivity Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against SNF1LK. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name SNF1LK
Background SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.
Molecular Weight 85 kDa
Gene ID 150094
NCBI Accession NM_173354, NP_775490
UniProt P57059
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 783 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Salt-Inducible Kinase 1 (SIK1) (N-Term) antibody anti-Salt-Inducible Kinase 1 (SIK1) (N-Term) antibody
anti-Salt-Inducible Kinase 1 (SIK1) (N-Term) antibody (2) anti-Salt-Inducible Kinase 1 (SIK1) (N-Term) antibody (Image 2)
Background publications Nishimura, Hayashi, Inada et al.: "Molecular cloning and characterization of mammalian homologues of vesicle-associated membrane protein-associated (VAMP-associated) proteins." in: Biochemical and biophysical research communications, Vol. 254, Issue 1, pp. 21-6, 1999 (PubMed).

Hosts (39), (5)
Reactivities (42), (18), (17), (12), (12)
Applications (31), (23), (11), (10), (6), (5), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top