Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310797

GINS Complex Subunit 2 (Psf2 Homolog) (GINS2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PSF2, Pfs2, HSPC037, AI323585, 2210013I18Rik, 4833427B12Rik, RGD1311055, zgc:112262, si:dkey-265o13.3, hspc037, pfs2, psf2
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310797
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GINS2 antibody: synthetic peptide directed towards the C terminal of human GINS2
Sequence VRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQ PLESTQSQDF
Predicted Reactivity Dog : 92%, Human : 92%, Horse : 85%, Rat : 85%, Bovine : 78%
Characteristics This is a rabbit polyclonal antibody against GINS2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GINS2
Background The yeast heterotetrameric GINS complex is made up of Sld5, Psf1, Psf2, and Psf3. The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts.The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4, MIM 610611), Psf1 (GINS1, MIM 610608), Psf2, and Psf3 (GINS3, MIM 610610). The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additional information about the GINS complex.
Molecular Weight 21kDa
Gene ID 51659
NCBI Accession NP_057179, NM_016095
UniProt Q9Y248
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GINS2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Matsuoka, Ballif, Smogorzewska et al.: "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." in: Science (New York, N.Y.), Vol. 316, Issue 5828, pp. 1160-6, 2007 (PubMed).

Alternatives for antigen "GINS Complex Subunit 2 (Psf2 Homolog) (GINS2)", type "Antibodies"
Hosts (7), (2), (1)
Reactivities (9), (3), (3), (1), (1), (1), (1)
Applications (10), (3), (1), (1)
Epitopes (2), (1), (1), (1), (1)
Beacon