GINS Complex Subunit 2 (Psf2 Homolog) (GINS2) (C-Term) antibody

Details for Product No. ABIN310797
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PSF2, Pfs2, HSPC037, AI323585, 2210013I18Rik, 4833427B12Rik, RGD1311055, zgc:112262, si:dkey-265o13.3, hspc037, pfs2, psf2
Epitope
C-Term
(2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(10), (3), (3), (1), (1), (1), (1)
Host
Rabbit
(8), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (4), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310797
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human GINS2
Sequence VRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQ PLESTQSQDF
Predicted Reactivity Dog : 92 %, Human : 92 %, Horse : 82 %, Rat : 82 %, Bovine : 72 %
Characteristics This is a rabbit polyclonal antibody against GINS2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GINS2
Background The yeast heterotetrameric GINS complex is made up of Sld5, Psf1, Psf2, and Psf3. The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts.The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4, MIM 610611), Psf1 (GINS1, MIM 610608), Psf2, and Psf3 (GINS3, MIM 610610). The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additional information about the GINS complex.
Molecular Weight 21 kDa
Gene ID 51659
NCBI Accession NM_016095, NP_057179
UniProt Q9Y248
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 185 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-GINS Complex Subunit 2 (Psf2 Homolog) (GINS2) (C-Term) antibody WB Suggested Anti-GINS2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Matsuoka, Ballif, Smogorzewska et al.: "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." in: Science (New York, N.Y.), Vol. 316, Issue 5828, pp. 1160-6, 2007 (PubMed).

Hosts (8), (3)
Reactivities (10), (3), (3), (1), (1), (1), (1)
Applications (11), (4), (2), (1), (1)
Epitopes (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top