Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310895

Protein tyrosine Phosphatase-Like A Domain Containing 1 (PTPLAD1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms B-IND1, HACD3, HSPC121, 4930523M17Rik, AW742319, B-ind1, Hspc121, RGD1565496, HACD
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310895
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PTPLAD1 antibody: synthetic peptide directed towards the N terminal of human PTPLAD1
Sequence WLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGY LFMYNLVQFL
Predicted Reactivity Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Dog : 92%
Characteristics This is a rabbit polyclonal antibody against PTPLAD1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PTPLAD1
Background PTPLAD1 is a multi-pass membrane protein. It belongs to the PTPLA family and contains 1 CS domain. PTPLAD1 (hB-ind1) plays a crucial role in HCV RNA replication and the propagation of JFH1 virus through interaction with viral and host proteins. It is involved in Rac1-signaling pathways leading to the modulation of gene expression.
Molecular Weight 43kDa
Gene ID 51495
NCBI Accession NP_057479, NM_016395
UniProt Q9P035
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PTPLAD1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Taguwa, Okamoto, Abe et al.: "Human butyrate-induced transcript 1 interacts with hepatitis C virus NS5A and regulates viral replication." in: Journal of virology, Vol. 82, Issue 6, pp. 2631-41, 2008 (PubMed).

Alternatives for antigen "Protein tyrosine Phosphatase-Like A Domain Containing 1 (PTPLAD1)", type "Antibodies"
Hosts (5), (5)
Reactivities (9)
Applications (10), (4), (2), (1)
Epitopes (4), (3), (2), (2), (1)
Beacon