Protein tyrosine Phosphatase-Like A Domain Containing 1 (PTPLAD1) (N-Term) antibody

Details for Product No. ABIN310895
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms B-IND1, HACD3, HSPC121, 4930523M17Rik, AW742319, B-ind1, Hspc121, RGD1565496, HACD
Epitope
N-Term
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(2)
Host
Rabbit
(3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3)
Pubmed 1 reference available
Catalog no. ABIN310895
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PTPLAD1
Sequence WLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGY LFMYNLVQFL
Predicted Reactivity Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Dog : 90 %
Characteristics This is a rabbit polyclonal antibody against PTPLAD1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PTPLAD1
Background PTPLAD1 is a multi-pass membrane protein. It belongs to the PTPLA family and contains 1 CS domain. PTPLAD1 (hB-ind1) plays a crucial role in HCV RNA replication and the propagation of JFH1 virus through interaction with viral and host proteins. It is involved in Rac1-signaling pathways leading to the modulation of gene expression.
Molecular Weight 43 kDa
Gene ID 51495
NCBI Accession NM_016395, NP_057479
UniProt Q9P035
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 362 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Taguwa, Okamoto, Abe et al.: "Human butyrate-induced transcript 1 interacts with hepatitis C virus NS5A and regulates viral replication." in: Journal of virology, Vol. 82, Issue 6, pp. 2631-41, 2008 (PubMed).

Hosts (3)
Reactivities (2)
Applications (3)
Epitopes (1), (1)
back to top