Protein tyrosine Phosphatase-Like A Domain Containing 1 (PTPLAD1) (N-Term) antibody

Details for Product No. ABIN310895
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms B-IND1, HACD3, HSPC121, 4930523M17Rik, AW742319, B-ind1, Hspc121, RGD1565496, HACD
Epitope
N-Term
(3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(7)
Host
Rabbit
(5), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN310895
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PTPLAD1
Sequence WLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGY LFMYNLVQFL
Predicted Reactivity Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Dog : 90 %
Characteristics This is a rabbit polyclonal antibody against PTPLAD1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PTPLAD1
Background PTPLAD1 is a multi-pass membrane protein. It belongs to the PTPLA family and contains 1 CS domain. PTPLAD1 (hB-ind1) plays a crucial role in HCV RNA replication and the propagation of JFH1 virus through interaction with viral and host proteins. It is involved in Rac1-signaling pathways leading to the modulation of gene expression.
Molecular Weight 43 kDa
Gene ID 51495
NCBI Accession NM_016395, NP_057479
UniProt Q9P035
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 362 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Taguwa, Okamoto, Abe et al.: "Human butyrate-induced transcript 1 interacts with hepatitis C virus NS5A and regulates viral replication." in: Journal of virology, Vol. 82, Issue 6, pp. 2631-41, 2008 (PubMed).

Hosts (5), (3)
Reactivities (7)
Applications (8), (3), (2), (1)
Epitopes (3), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top