RUN Domain Containing 2A (RUNDC2A) (N-Term) antibody

Details for Product No. ABIN310933
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933437K13Rik, ENSMUSG00000079738, Gm11170, Gm1737, Gm930, Rundc2a, RGD1565890, A-388D4.1, RUNDC2A, FLJ12363
Epitope
N-Term
(8), (7), (3), (3), (1)
Reactivity
Rat (Rattus), Cow (Bovine), Human
(18), (1)
Host
Rabbit
(12), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(18), (10), (8), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310933
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RUNDC2A
Sequence MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDS RVTCLCAQFE
Predicted Reactivity Bovine :100 %,   Human :100 %,   Green puffer :90 %,   Black-legged tick :70 %,  
Characteristics This is a rabbit polyclonal antibody against RUNDC2A. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name RUNDC2A
Background The function remains unknown.
Molecular Weight 42 kDa
Gene ID 84127
NCBI Accession NM_032167, NP_115543
UniProt Q9HA26
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 375 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RUN Domain Containing 2A (RUNDC2A) (N-Term) antibody anti-RUN Domain Containing 2A (RUNDC2A) (N-Term) antibody
anti-RUN Domain Containing 2A (RUNDC2A) (N-Term) antibody (2) anti-RUN Domain Containing 2A (RUNDC2A) (N-Term) antibody (Image 2)
Background publications Bonaldo, Lennon, Soares: "Normalization and subtraction: two approaches to facilitate gene discovery." in: Genome research, Vol. 6, Issue 9, pp. 791-806, 1997 (PubMed).

Hosts (12), (6)
Reactivities (18), (1)
Applications (18), (10), (8), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (3), (3), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top