Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310933

RUN Domain Containing 2A (RUNDC2A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933437K13Rik, ENSMUSG00000079738, Gm11170, Gm1737, Gm930, Rundc2a, RGD1565890, A-388D4.1, RUNDC2A, FLJ12363
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310933
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RUNDC2A antibody: synthetic peptide directed towards the N terminal of human RUNDC2A
Sequence MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDS RVTCLCAQFE
Predicted Reactivity Bovine :100%,   Human :100%,   Green puffer :92%,   Black-legged tick :78%,  
Characteristics This is a rabbit polyclonal antibody against RUNDC2A. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name RUNDC2A
Background The function remains unknown.
Molecular Weight 42kDa
Gene ID 84127
NCBI Accession NP_115543, NM_032167
UniProt Q9HA26
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RUNDC2A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bonaldo, Lennon, Soares: "Normalization and subtraction: two approaches to facilitate gene discovery." in: Genome research, Vol. 6, Issue 9, pp. 791-806, 1997 (PubMed).

Alternatives for antigen "RUN Domain Containing 2A (RUNDC2A)", type "Antibodies"
Hosts (7), (5)
Reactivities (12), (1)
Applications (12), (6), (5), (2), (1)
Epitopes (5), (3), (2), (2), (1), (1)
Beacon