Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310936

TAM41, Mitochondrial Translocator Assembly and Maintenance Protein, Homolog (S. Cerevisiae) (TAMM41) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C3orf31, RAM41, TAM41, C20H3orf31, 1500001M20Rik, C22H3orf31
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310936
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C3orf31 antibody: synthetic peptide directed towards the N terminal of human C3orf31
Sequence QSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKN AMLDFVFTVD
Predicted Reactivity Bovine :100%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against C3orf31. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name C3orf31
Background C3orf31 may be involved in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Molecular Weight 36kDa
Gene ID 132001
NCBI Accession NP_620162, NM_138807
UniProt Q96BW9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C3orf31 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wiemann, Weil, Wellenreuther et al.: "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." in: Genome research, Vol. 11, Issue 3, pp. 422-35, 2001 (PubMed).

Alternatives for antigen "TAM41, Mitochondrial Translocator Assembly and Maintenance Protein, Homolog (S. Cerevisiae) (TAMM41)", type "Antibodies"
Hosts (21)
Reactivities (21), (16), (13), (13), (12), (12), (1), (1)
Applications (12), (10), (5), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1), (1), (1), (1)
Beacon