Did you know that you can buy products from over 140 different suppliers from us?

TAM41, Mitochondrial Translocator Assembly and Maintenance Protein, Homolog (S. Cerevisiae) (TAMM41) (N-Term) antibody

Details for Product No. ABIN310936
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C3orf31, RAM41, TAM41, C20H3orf31, 1500001M20Rik, C22H3orf31
Epitope
N-Term
(7), (7), (1), (1), (1)
Reactivity
Cow (Bovine), Human
(25), (12), (12), (12), (12), (12)
Host
Rabbit
(25)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(16), (10), (9), (7), (3), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310936
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C3orf31
Sequence QSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKN AMLDFVFTVD
Predicted Reactivity Bovine :100 %,   Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against C3orf31. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name C3orf31
Background C3orf31 may be involved in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Molecular Weight 36 kDa
Gene ID 132001
NCBI Accession NM_138807, NP_620162
UniProt Q96BW9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 316 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-TAM41, Mitochondrial Translocator Assembly and Maintenance Protein, Homolog (S. Cerevisiae) (TAMM41) (N-Term) antibody anti-TAM41, Mitochondrial Translocator Assembly and Maintenance Protein, Homolog (S. Cerevisiae) (TAMM41) (N-Term) antibody
anti-TAM41, Mitochondrial Translocator Assembly and Maintenance Protein, Homolog (S. Cerevisiae) (TAMM41) (N-Term) antibody (2) anti-TAM41, Mitochondrial Translocator Assembly and Maintenance Protein, Homolog (S. Cerevisiae) (TAMM41) (N-Term) antibody (Image 2)
Background publications Wiemann, Weil, Wellenreuther et al.: "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." in: Genome research, Vol. 11, Issue 3, pp. 422-35, 2001 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310936
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top