Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310993

Insulin-Like Growth Factor Binding Protein 7 (IGFBP7) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AGM, Fstl2, Mac25, FSTL2, IBP-7, IGFBP-7, IGFBP-7v, IGFBPRP1, MAC25, PSF, RAMSVPS, TAF, zgc:85888
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310993
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IGFBP7 antibody: synthetic peptide directed towards the C terminal of human IGFBP7
Sequence RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAS AKITVVDALH
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Rabbit : 100%, Rat : 100%, Mouse : 92%, Pig : 92%, Sheep : 92%
Characteristics This is a rabbit polyclonal antibody against IGFBP7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name IGFBP7
Background IGFBP7 contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 IGFBP N-terminal domain and 1 Kazal-like domain. It binds IGF-I and IGF-II with a relatively low affinity. IGFBP7 stimulates prostacyclin (PGI2) production.
Molecular Weight 29kDa
Gene ID 3490
NCBI Accession NP_001544, NM_001553
UniProt Q16270
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IGFBP7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wajapeyee, Serra, Zhu et al.: "Oncogenic BRAF induces senescence and apoptosis through pathways mediated by the secreted protein IGFBP7." in: Cell, Vol. 132, Issue 3, pp. 363-74, 2008 (PubMed).

Alternatives for antigen "Insulin-Like Growth Factor Binding Protein 7 (IGFBP7)", type "Antibodies"
Hosts (37), (9), (2)
Reactivities (43), (18), (17), (16), (12)
Applications (34), (31), (10), (10), (6), (1)
Conjugates (6), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (2), (1)
Beacon