Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311072

N-Acetyltransferase 6 (GCN5-Related) (NAT6) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FUS2, FUS-2, AI225910, Fus2
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311072
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NAT6 antibody: synthetic peptide directed towards the C terminal of human NAT6
Sequence GYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPN LTAQAAPRGP
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against NAT6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NAT6
Background NAT6 belongs to the acetyltransferase family. It contains 1 N-acetyltransferase domain. NAT6 seems to be involved in N-acetylation. Acts on peptides with a N-terminal Met followed by Asp/Glu/Asn. It may act as a tumor suppressor. Defects in NAT6 are found in non-small cell lung cancer (NSCLC) cell lines.
Molecular Weight 34kDa
Gene ID 24142
NCBI Accession NP_036323, NM_012191
UniProt Q93015
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NAT6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Muzny, Scherer, Kaul et al.: "The DNA sequence, annotation and analysis of human chromosome 3." in: Nature, Vol. 440, Issue 7088, pp. 1194-8, 2006 (PubMed).

Alternatives for antigen "N-Acetyltransferase 6 (GCN5-Related) (NAT6)", type "Antibodies"
Hosts (13), (9), (4)
Reactivities (30), (3)
Applications (20), (13), (5), (3), (2), (1), (1)
Epitopes (6), (3), (2), (1), (1), (1), (1), (1)
Beacon