Did you know that you can buy products from over 140 different suppliers from us?

N-Acetyltransferase 6 (GCN5-Related) (NAT6) (C-Term) antibody

Details for Product No. ABIN311072
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI225910, Fus2, FUS-2, FUS2
Epitope
C-Term
(11), (7), (6), (2), (1), (1), (1), (1)
Reactivity
Human
(33), (4), (1)
Host
Rabbit
(18), (14), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(25), (16), (5), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311072
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human NAT6
Sequence GYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPN LTAQAAPRGP
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against NAT6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NAT6
Background NAT6 belongs to the acetyltransferase family. It contains 1 N-acetyltransferase domain. NAT6 seems to be involved in N-acetylation. Acts on peptides with a N-terminal Met followed by Asp/Glu/Asn. It may act as a tumor suppressor. Defects in NAT6 are found in non-small cell lung cancer (NSCLC) cell lines.
Molecular Weight 34 kDa
Gene ID 24142
NCBI Accession NM_012191, NP_036323
UniProt Q93015
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 308 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-N-Acetyltransferase 6 (GCN5-Related) (NAT6) (C-Term) antibody WB Suggested Anti-NAT6 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Muzny, Scherer, Kaul et al.: "The DNA sequence, annotation and analysis of human chromosome 3." in: Nature, Vol. 440, Issue 7088, pp. 1194-8, 2006 (PubMed).

Validation Images
back to top