Enoyl CoA Hydratase Domain Containing 1 (ECHDC1) (Middle Region) antibody

Details for Product No. ABIN311091
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MMCD, dJ351K20.2, 1700028A24Rik, AI314462, AI930038, D10Ertd667e
Epitope
Middle Region
(3), (2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
(9), (4)
Host
Rabbit
(8), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (3), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN311091
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ECHDC1
Sequence GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNA VKSLGTPEDG
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 90 %, Rabbit : 90 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against ECHDC1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ECHDC1
Background ECHDC1 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC1 remains unknown.
Molecular Weight 33 kDa
Gene ID 55862
NCBI Accession NM_001002030, NP_001002030
UniProt Q9NTX5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 301 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Enoyl CoA Hydratase Domain Containing 1 (ECHDC1) (Middle Region) antibody WB Suggested Anti-ECHDC1 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
Background publications Gold, Kirchhoff, Stefanov et al.: "Genome-wide association study provides evidence for a breast cancer risk locus at 6q22.33." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 11, pp. 4340-5, 2008 (PubMed).

Hosts (8), (2)
Reactivities (9), (4)
Applications (10), (3), (2), (2)
Epitopes (3), (2), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top