Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311091

Enoyl CoA Hydratase Domain Containing 1 (ECHDC1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MMCD, dJ351K20.2, 1700028A24Rik, AI314462, AI930038, D10Ertd667e
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311091
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ECHDC1 antibody: synthetic peptide directed towards the middle region of human ECHDC1
Sequence GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNA VKSLGTPEDG
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 92%, Rabbit : 92%, African clawed frog : 84%
Characteristics This is a rabbit polyclonal antibody against ECHDC1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ECHDC1
Background ECHDC1 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC1 remains unknown.
Molecular Weight 33kDa
Gene ID 55862
NCBI Accession NP_001002030, NM_001002030
UniProt Q9NTX5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ECHDC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gold, Kirchhoff, Stefanov et al.: "Genome-wide association study provides evidence for a breast cancer risk locus at 6q22.33." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 11, pp. 4340-5, 2008 (PubMed).

Alternatives for antigen "Enoyl CoA Hydratase Domain Containing 1 (ECHDC1)", type "Antibodies"
Hosts (7), (2)
Reactivities (8), (4)
Applications (9), (3), (2), (1)
Epitopes (4), (2), (2), (2), (1), (1)
Beacon