Lipid Phosphate Phosphatase-Related Protein Type 2 (LPPR2) (Middle Region) antibody

Details for Product No. ABIN311218
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Lppr2, PRG-4, Prg-4, PRG4
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(3)
Host
Rabbit
(4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4), (1)
Pubmed 1 reference available
Catalog no. ABIN311218
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human LPPR2
Sequence NYTALGCLPPSPDRPGPDRFVTDQGACAGSPSLVAAARRA FPCKDAALCA
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against LPPR2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LPPR2
Background LPPR2 is a multi-pass membrane protein and belongs to the PA-phosphatase related phosphoesterase family. LPPR2 shows dynamic expression regulation during brain development and neuronal excitation.
Molecular Weight 37 kDa
Gene ID 64748
NCBI Accession NM_022737, NP_073574
UniProt Q96GM1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 343 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Lipid Phosphate Phosphatase-Related Protein Type 2 (LPPR2) (Middle Region) antibody WB Suggested Anti-LPPR2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Background publications Savaskan, Bräuer, Nitsch: "Molecular cloning and expression regulation of PRG-3, a new member of the plasticity-related gene family." in: The European journal of neuroscience, Vol. 19, Issue 1, pp. 212-20, 2004 (PubMed).

Hosts (4)
Reactivities (3)
Applications (4), (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top