Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311242

Fatty Acyl CoA Reductase 1 (FAR1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MLSTD2, SDR10E1, 2600011M19Rik, 2900034E22Rik, 3732409C05Rik, AI850429, Mlstd2, MQJ16.4, MQJ16_4, fatty acid reductase 1, mlstd2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311242
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MLSTD2 antibody: synthetic peptide directed towards the N terminal of human MLSTD2
Sequence LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRD ENPDFREKII
Predicted Reactivity Bovine :100%,   Mouse :100%,   Rat :100%,   Dog :100%,   Sumatran orangutan :100%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against MLSTD2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name MLSTD2
Background MLSTD2 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.
Molecular Weight 59kDa
Gene ID 84188
NCBI Accession NP_115604, NM_032228
UniProt Q8WVX9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MLSTD2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Fatty Acyl CoA Reductase 1 (FAR1)", type "Antibodies"
Hosts (3)
Reactivities (2)
Applications (2), (1), (1)
Epitopes (1)
Beacon