Did you know that you can buy products from over 140 different suppliers from us?

Fatty Acyl CoA Reductase 1 (FAR1) (N-Term) antibody

Details for Product No. ABIN311242
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MLSTD2, SDR10E1, 2600011M19Rik, 2900034E22Rik, 3732409C05Rik, AI850429, Mlstd2, MQJ16.4, MQJ16_4, fatty acid reductase 1, mlstd2
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(2)
Host
Rabbit
(3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN311242
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MLSTD2
Sequence LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRD ENPDFREKII
Predicted Reactivity Bovine :100 %,   Mouse :100 %,   Rat :100 %,   Dog :100 %,   Sumatran orangutan :100 %,   Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against MLSTD2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name MLSTD2
Background MLSTD2 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.
Molecular Weight 59 kDa
Gene ID 84188
NCBI Accession NM_032228, NP_115604
UniProt Q8WVX9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 515 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Fatty Acyl CoA Reductase 1 (FAR1) (N-Term) antibody WB Suggested Anti-MLSTD2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (3)
Reactivities (2)
Applications (2), (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311242
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top