Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311251

Abhydrolase Domain Containing 13 (ABHD13) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BEM46L1, C13orf6, RP11-153I24.2, bA153I24.2, AI463703, AI788994, 1110065L07Rik, RGD1308317, zgc:123286
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311251
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ABHD13 antibody: synthetic peptide directed towards the N terminal of human ABHD13
Sequence SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPY SPTIIYFHGN
Predicted Reactivity Horse : 100%, Bovine : 92%, Pig : 92%, Rat : 85%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against ABHD13. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ABHD13
Background ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Molecular Weight 38kDa
Gene ID 84945
NCBI Accession NP_116248, NM_032859
UniProt Q7L211
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ABHD13 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dunham, Matthews, Burton et al.: "The DNA sequence and analysis of human chromosome 13." in: Nature, Vol. 428, Issue 6982, pp. 522-8, 2004 (PubMed).

Alternatives for antigen "Abhydrolase Domain Containing 13 (ABHD13)", type "Antibodies"
Hosts (7)
Reactivities (5), (3), (3), (3), (3), (3), (2)
Applications (7), (2)
Epitopes (3), (2)
Beacon