Abhydrolase Domain Containing 13 (ABHD13) (N-Term) antibody

Details for Product No. ABIN311251
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BEM46L1, C13orf6, RP11-153I24.2, bA153I24.2, AI463703, AI788994, 1110065L07Rik, RGD1308317, zgc:123286
Epitope
N-Term
(3), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
(5), (3), (3), (3), (3), (3), (2)
Host
Rabbit
(7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7)
Pubmed 1 reference available
Catalog no. ABIN311251
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ABHD13
Sequence SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPY SPTIIYFHGN
Predicted Reactivity Horse : 100 %, Bovine : 90 %, Pig : 90 %, Rat : 80 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against ABHD13. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ABHD13
Background ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Molecular Weight 38 kDa
Gene ID 84945
NCBI Accession NM_032859, NP_116248
UniProt Q7L211
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 337 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Abhydrolase Domain Containing 13 (ABHD13) (N-Term) antibody WB Suggested Anti-ABHD13 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta
Background publications Dunham, Matthews, Burton et al.: "The DNA sequence and analysis of human chromosome 13." in: Nature, Vol. 428, Issue 6982, pp. 522-8, 2004 (PubMed).

Hosts (7)
Reactivities (5), (3), (3), (3), (3), (3), (2)
Applications (7)
Epitopes (3), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top