Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311328

Prostate Tumor Overexpressed 1 (PTOV1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ACID2, PTOV-1, 1110030G05Rik, AU041779, Gcap3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311328
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PTOV1 antibody: synthetic peptide directed towards the N terminal of human PTOV1
Sequence DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQL LTTLGPLFRN
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%
Characteristics This is a rabbit polyclonal antibody against PTOV1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PTOV1
Background PTOV1 belongs to the Mediator complex subunit 25 family, PTOV1 subfamily. It may activate transcription and is required for nuclear translocation of FLOT1. PTOV1 promotes cell proliferation.
Molecular Weight 47kDa
Gene ID 53635
NCBI Accession NP_059128, NM_017432
UniProt Q86YD1
Research Area Cancer, Cell Cycle, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PTOV1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Santamaría, Castellanos, Gómez et al.: "PTOV1 enables the nuclear translocation and mitogenic activity of flotillin-1, a major protein of lipid rafts." in: Molecular and cellular biology, Vol. 25, Issue 5, pp. 1900-11, 2005 (PubMed).

Alternatives for antigen "Prostate Tumor Overexpressed 1 (PTOV1)", type "Antibodies"
Hosts (19)
Reactivities (19), (17), (13), (1)
Applications (10), (10), (5), (5), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (2)
Beacon