Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311441

MICAL-Like 1 (MICALL1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MICAL-L1, MIRAB13, 260, AI448246, D15Mit260, D15N2e, EST573322, EST820961, MIRab13, mKIAA1668, mirab13, mical-l1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311441
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MICALL1 antibody: synthetic peptide directed towards the N terminal of human MICALL1
Sequence ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQ QLAEDAKDVP
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against MICALL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MICALL1
Background MICALL1 contains 1 CH (calponin-homology) domain and 1 LIM zinc-binding domain. It may be a cytoskeletal regulator.
Molecular Weight 93kDa
Gene ID 85377
NCBI Accession NP_203744, NM_033386
UniProt Q8N3F8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MICALL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Jin, Smith, Stark et al.: "Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization." in: Current biology : CB, Vol. 14, Issue 16, pp. 1436-50, 2004 (PubMed).

Alternatives for antigen "MICAL-Like 1 (MICALL1)", type "Antibodies"
Hosts (6), (2)
Reactivities (8)
Applications (8), (3), (2), (2), (1), (1)
Epitopes (4), (2), (1), (1), (1)
Beacon