Did you know that you can buy products from over 140 different suppliers from us?

MICAL-Like 1 (MICALL1) (N-Term) antibody

Details for Product No. ABIN311441
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MICAL-L1, MIRAB13, 260, AI448246, D15Mit260, D15N2e, EST573322, EST820961, MIRab13, mKIAA1668, mirab13, mical-l1
Epitope
N-Term
(9), (8), (1), (1), (1)
Reactivity
Human
(13)
Host
Rabbit
(12), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (8), (7), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN311441
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MICALL1
Sequence ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQ QLAEDAKDVP
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against MICALL1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MICALL1
Background MICALL1 contains 1 CH (calponin-homology) domain and 1 LIM zinc-binding domain. It may be a cytoskeletal regulator.
Molecular Weight 93 kDa
Gene ID 85377
NCBI Accession NM_033386, NP_203744
UniProt Q8N3F8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 863 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-MICAL-Like 1 (MICALL1) (N-Term) antibody WB Suggested Anti-MICALL1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver
Background publications Jin, Smith, Stark et al.: "Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization." in: Current biology : CB, Vol. 14, Issue 16, pp. 1436-50, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311441
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top