Stromal Antigen 3 (STAG3) (Middle Region) antibody

Details for Product No. ABIN311619
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms SA-2, STAG3
Epitope
Middle Region
(3), (2), (1), (1)
Reactivity
Human
(14), (3)
Host
Rabbit
(11), (8)
Clonality
Polyclonal
Application
Western Blotting (WB)
(13), (11), (1)
Pubmed 1 reference available
Catalog no. ABIN311619
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human STAG3
Sequence VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDR MVAFCELCQS
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against STAG3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name STAG3
Background STAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I.
Molecular Weight 135 kDa
Gene ID 10734
NCBI Accession NM_012447, NP_036579
UniProt Q9UJ98
Research Area Chromatin and Nuclear Signaling, Cell Cycle
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1225 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Stromal Antigen 3 (STAG3) (Middle Region) antibody WB Suggested Anti-STAG3 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
Background publications Barber, McManus, Yuen et al.: "Chromatid cohesion defects may underlie chromosome instability in human colorectal cancers." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 9, pp. 3443-8, 2008 (PubMed).

Hosts (11), (8)
Reactivities (14), (3)
Applications (13), (11), (1)
Epitopes (3), (2), (1), (1)
back to top