Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311619

Stromal Antigen 3 (STAG3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SA-2, STAG3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311619
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-STAG3 antibody: synthetic peptide directed towards the middle region of human STAG3
Sequence VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDR MVAFCELCQS
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against STAG3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name STAG3
Background STAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I.
Molecular Weight 135kDa
Gene ID 10734
NCBI Accession NP_036579, NM_012447
UniProt Q9UJ98
Research Area Chromatin and Nuclear Signaling, Cell Cycle
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-STAG3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Barber, McManus, Yuen et al.: "Chromatid cohesion defects may underlie chromosome instability in human colorectal cancers." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 9, pp. 3443-8, 2008 (PubMed).

Alternatives for antigen "Stromal Antigen 3 (STAG3)", type "Antibodies"
Hosts (9), (9)
Reactivities (12), (4)
Applications (13), (9), (1)
Epitopes (3), (1), (1)
Beacon