Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404747

RNA Binding Motif Protein 6 (RBM6) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 3G2, DEF-3, DEF3, HLC-11, NY-LU-12, g16, RGD1560367, 4930506F14Rik, Def-3, mKIAA4015
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404747
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RBM6 antibody: synthetic peptide directed towards the N terminal of human RBM6
Sequence RNRDVSDLDFRDKDGTQVDFRGRGSGTTDLDFRDRDTPHS DFRGRHRSRT
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Guinea pig : 92%, Rat : 92%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against RBM6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RBM6
Background RBM6 contains 1 G-patch domain and 1 RRM (RNA recognition motif) domain.It specifically binds poly(G) RNA homopolymers in vitro.
Molecular Weight 129kDa
Gene ID 10180
NCBI Accession NP_005768, NM_005777
UniProt P78332
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RBM6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gu, Mercher, Tyner et al.: "A novel fusion of RBM6 to CSF1R in acute megakaryoblastic leukemia." in: Blood, Vol. 110, Issue 1, pp. 323-33, 2007 (PubMed).

Alternatives for antigen "RNA Binding Motif Protein 6 (RBM6)", type "Antibodies"
Hosts (12), (4)
Reactivities (15), (8), (2), (1), (1)
Applications (15), (12), (7), (5), (2), (1), (1), (1)
Epitopes (2), (2), (1), (1), (1)
Beacon