Did you know that you can buy products from over 140 different suppliers from us?

Activating Transcription Factor 6 beta (ATF6B) (Middle Region) antibody

Details for Product No. ABIN404752
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CREB-RP, CREBL1, G13, Crebl1, AA617266, ATF6beta, Creb-rp
Epitope
Middle Region
(8), (7), (3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Human
(41), (17), (15), (13), (13), (13), (2)
Host
Rabbit
(39), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(32), (21), (10), (3), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN404752
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CREBL1
Sequence FNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQPR KKSPPVKAVP
Predicted Reactivity Pig : 84 %
Characteristics This is a rabbit polyclonal antibody against CREBL1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CREBL1
Background ATF6B(CREBL1) is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. ATF6B is normally found in the membrane of the endoplasmic reticulum, however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene.The protein encoded by this gene bears sequence similarity with the Creb/ATF subfamily of the bZip superfamily of transcription factors. It localizes to both the cytoplasm and the nucleus. The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6.
Molecular Weight 77 kDa
Gene ID 1388
NCBI Accession NM_004381, NP_004372
UniProt Q99941
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 703 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Activating Transcription Factor 6 beta (ATF6B) (Middle Region) antibody WB Suggested Anti-CREBL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle
Background publications Xie, Rowen, Aguado et al.: "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse." in: Genome research, Vol. 13, Issue 12, pp. 2621-36, 2003 (PubMed).

Hosts (39), (2)
Reactivities (41), (17), (15), (13), (13), (13), (2)
Applications (32), (21), (10), (3), (3), (2)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (3), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN404752
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top