LIM Domain Binding 2 (LDB2) (Middle Region) antibody

Details for Product No. ABIN404792
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LDB1, CLIM1, Ldb3, CLP-36, AI035351, AW146358, CLIM-1, ldb2, clim1, clim1b, LDB2
Epitope
Middle Region
(5), (4), (4), (3), (2), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Human, Chicken
(21), (11), (4), (3), (2), (2), (2), (1), (1)
Host
Rabbit
(21), (6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(24), (11), (10), (6), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN404792
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human LDB2
Sequence LENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQET KSENPPPQAS
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, Mouse : 90 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against LDB2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LDB2
Background LDB2 belongs to the LDB family. LDB2 binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. LIM domains are required for both inhibitory effects on LIM homeodomain transcription factors and synergistic transcriptional activation events. The inhibitory actions of the LIM domain can often be overcome by the LIM co-regulators known as CLIM2, LDB2 and NLI. LIM homeoproteins and CLIMs are involved in a variety of developmental processes.
Molecular Weight 43 kDa
Gene ID 9079
NCBI Accession NM_001290, NP_001281
UniProt O43679
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 373 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Hosts (21), (6)
Reactivities (21), (11), (4), (3), (2), (2), (2), (1), (1)
Applications (24), (11), (10), (6), (2), (1), (1)
Epitopes (5), (4), (4), (3), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top