Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404792

LIM Domain Binding 2 (LDB2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LDB1, CLIM1, Ldb3, CLP-36, AI035351, AW146358, CLIM-1, ldb2, clim1, clim1b, LDB2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404792
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LDB2 antibody: synthetic peptide directed towards the middle region of human LDB2
Sequence LENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQET KSENPPPQAS
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, Mouse : 92%, Dog : 83%
Characteristics This is a rabbit polyclonal antibody against LDB2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LDB2
Background LDB2 belongs to the LDB family. LDB2 binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. LIM domains are required for both inhibitory effects on LIM homeodomain transcription factors and synergistic transcriptional activation events. The inhibitory actions of the LIM domain can often be overcome by the LIM co-regulators known as CLIM2, LDB2 and NLI. LIM homeoproteins and CLIMs are involved in a variety of developmental processes.
Molecular Weight 43kDa
Gene ID 9079
NCBI Accession NP_001281, NM_001290
UniProt O43679
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LDB2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Alternatives for antigen "LIM Domain Binding 2 (LDB2)", type "Antibodies"
Hosts (22), (6)
Reactivities (22), (12), (5), (4), (3), (2), (2), (1), (1)
Applications (26), (15), (10), (7), (4), (1), (1)
Epitopes (5), (5), (4), (3), (2), (1), (1)
Beacon