Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404898

Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5330431N24Rik, AI851877, ARTD11, HIN1L, RGD1561791, C12orf6, fd14a11, wu:fd14a11, zgc:165536, parp11, MGC82612, PARP11
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404898
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PARP11 antibody: synthetic peptide directed towards the middle region of human PARP11
Sequence IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGD SKYMRPPSKD
Predicted Reactivity Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Dog : 92%, Horse : 92%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against PARP11. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PARP11
Background PARP1 encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes. PARP1 can be cleaved resulting in fragements of 29 and 85 kDa.
Molecular Weight 39kDa
Gene ID 57097
NCBI Accession NP_065100, NM_020367
UniProt Q9NR21
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PARP11 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Muzny, Buhay et al.: "The finished DNA sequence of human chromosome 12." in: Nature, Vol. 440, Issue 7082, pp. 346-51, 2006 (PubMed).

Alternatives for antigen "Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11)", type "Antibodies"
Hosts (14)
Reactivities (11), (5), (5), (1), (1)
Applications (14), (6)
Epitopes (4), (1), (1), (1)
Beacon