Did you know that you can buy products from over 140 different suppliers from us?

Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11) (Middle Region) antibody

Details for Product No. ABIN404898
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms fd14a11, wu:fd14a11, zgc:165536, parp11, MGC82612, PARP11, ARTD11, C12orf6, 5330431N24Rik, AI851877, HIN1L, RGD1561791
Epitope
Middle Region
(4), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(14), (7), (7), (1), (1)
Host
Rabbit
(17)
Clonality
Polyclonal
Application
Western Blotting (WB)
(17), (7), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN404898
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PARP11
Sequence IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGD SKYMRPPSKD
Predicted Reactivity Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %, Dog : 90 %, Horse : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against PARP11. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PARP11
Background PARP1 encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes. PARP1 can be cleaved resulting in fragements of 29 and 85 kDa.
Molecular Weight 39 kDa
Gene ID 57097
NCBI Accession NM_020367, NP_065100
UniProt Q9NR21
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 331 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Scherer, Muzny, Buhay et al.: "The finished DNA sequence of human chromosome 12." in: Nature, Vol. 440, Issue 7082, pp. 346-51, 2006 (PubMed).

Validation Images
back to top