Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405210

SIX Homeobox 2 (SIX2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms six2, six1b, zgc:92332, six2-A
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405210
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SIX2 antibody: synthetic peptide directed towards the N terminal of human SIX2
Sequence WSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQ FSPHNHAKLQ
Predicted Reactivity African clawed frog : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against SIX2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SIX2
Background This gene is a member of the vertebrate gene family which encode proteins homologous to the Drosophila 'sine oculis' homeobox protein. SIX2 is a transcription factor which, like other members of this gene family, may be involved in limb or eye development.
Molecular Weight 32kDa
Gene ID 10736
NCBI Accession NP_058628, NM_016932
UniProt Q9NPC8
Research Area Organogenesis, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SIX2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Weber, Taylor, Winyard et al.: "SIX2 and BMP4 mutations associate with anomalous kidney development." in: Journal of the American Society of Nephrology : JASN, Vol. 19, Issue 5, pp. 891-903, 2008 (PubMed).

Alternatives for antigen "SIX Homeobox 2 (SIX2)", type "Antibodies"
Hosts (19), (4)
Reactivities (23), (14), (14), (12), (12)
Applications (13), (11), (10), (3), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1), (1), (1), (1)
Beacon