Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405243

Lysine (K)-Specific Demethylase 6A (KDM6A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms UTX, KABUK2, bA386N14.2, Utx, RGD1565481, Uty
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405243
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-UTX antibody: synthetic peptide directed towards the middle region of human UTX
Sequence KTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFT LAPPLPSASS
Predicted Reactivity Human : 100%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against UTX. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name UTX
Background UTX is a histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. It demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. UTX plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitent with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A.
Molecular Weight 154kDa
Gene ID 7403
NCBI Accession NP_066963, NM_021140
UniProt O15550
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-UTX antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hong, Cho, Yu et al.: "Identification of JmjC domain-containing UTX and JMJD3 as histone H3 lysine 27 demethylases." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 104, Issue 47, pp. 18439-44, 2007 (PubMed).

Alternatives for antigen "Lysine (K)-Specific Demethylase 6A (KDM6A)", type "Antibodies"
Hosts (7), (3)
Reactivities (9), (2)
Applications (10), (4), (1)
Epitopes (4), (1), (1), (1)
Beacon